Words Containing: M
There are 70,402 words,
23,673 phrases and
223 abbr's with
M in.
Best Scoring Words With: M
| More words | |||||||
|---|---|---|---|---|---|---|---|
| Rank | Word | Save? | Length | Usage | Points | Type | |
| 1 | jazzman | 7 | 34 | nounn | |||
| 2 | jazzmen | 7 | 34 | nounn | |||
| 3 | humbuzz | 7 | 32 | ||||
| 4 | mezuzah | 7 | 30 | nounn | |||
| 5 | muzzily | 7 | 30 | adverb, adjectiveadv, adj | |||
| 6 | mizzly | 6 | 29 | adjectiveadj | |||
| 7 | muzjiks | 7 | 29 | nounn | |||
| 8 | mizmaze | 7 | 29 | nounn | |||
| 9 | mazzard | 7 | 28 | nounn | |||
| 10 | muzzy | 5 | 28 | adjectiveadj | |||
| or scroll down to see all results... | |||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. | |||||||
Abbreviations (1)
mWords (131)
him8man5mom7may8men5met5mad6mum7tom5sam5arm5max12mon5map7mix12aim5gym9ram5jam12mac7mud6ham8sum5gum6mel5mid6dam6bam7mob7nam5pam7hum8mug6mam7cam7
...View all with 3 letters...
Abbreviations (78)
mrsminmeimaoatmjemlemmbaimfmphmpsmitmriumamvphmollmmsgdmzwpmrpmmevwmdecmamdgmtmcgmscmfamymcmvemfimonmrmya
...View all with 3 letters...
Words (679)
come8from9time6them9some6more6make10much11mean6home9must6name6made7came8same6many9move9mind7room6most6meet6miss6mine6game7team6calm8film9seem6mama8army9mess6mark10jump15mate6mary9
...View all with 4 letters...
Phrases (1)
mm hgAbbreviations (97)
romemarimajaramamarxmannsamiamosamonmusafemameirmiaoamormamomaiaarammahaxmasmorosiambaummauiguammpegyamahumeamunamuryumaomskmdmaomanzamahtml
...View all with 4 letters...
Words (1992)
money10maybe12woman10might11times7music9comes9means7women10small7dream8human10movie10mouth10month10marry10smell7meant7smoke11smart7moved11miles7smile7crime9madam10mommy14jimmy19match12major14magic10empty12enemy10names7blame9shame10
...View all with 5 letters...
Phrases (12)
gum upmop upi. m. peimany adam up100 mlmug uppr manhem inmix inmat upmary iAbbreviations (6)
Mar-17Mar-19Mar-02Mar-25May-01May-24Words (4032)
mother11coming11family14matter8myself14number10minute8making13moment10almost8become12master8moving12normal8middle10simple10system11became12camera10dreams9missed9summer10famous11simply13memory13animal8market12common12mister8german9bottom10victim13remain8manage9martin8
...View all with 6 letters...
Phrases (93)
con manmt etnapro temred elmc majorzoom inin namearm padcome byvamp upbump upat homecome upmap outjames imove upnaut miramp updim sumdrum upmary iimr. motobon motold manprim upmax outent manto a mantv roomglam upsea matsea mewmod conmodel tslam on
...View all with 6 letters...
Abbreviations (3)
ask.comomega-3omega-6Words (6630)
someone9morning10problem13minutes9married10anymore12welcome14promise11company16million9himself15meeting10imagine10missing10mistake13americamessage10amazing19michaelmachine14grandma11mission9mention9freedom13manager10example18awesome12meaning10medical12monster9numbers11somehow15program12stomach14smoking14
...View all with 7 letters...
Phrases (296)
no-see-umname tagmelt offsea holmmail outmock suncon gamebee balmnavy mansea mossbee mothbest manair mailde l'ormelike madair pumpbog mossgin millh. h. munroclam dipmot testtone armg. e. moorezea mayspalm offa la modeiron manclimb onclimb upbeer mugill famered meatviet nama. a. milnecake mix
...View all with 7 letters...
Abbreviations (1)
08-May-45Words (9027)
remember14tomorrow13somebody16americanmarriage11promised13bathroom15computer14complete14military13handsome14mountain10medicine13minister10criminal12murdered12romantic12familiar13murderer11magazine20becoming15swimming16movement15midnight15material10champion17sometime12dreaming12normally13customer12homework20charming16basement12ceremony15lifetime13
...View all with 8 letters...
Phrases (639)
gum myrrhfilm clipmelt downmary janeel muertofilm fernheat pumpjan smutsfree formmax bruchmax ernstjohn muirmail slotminor keysmall frytom wolfekauri gummess hallsumo ringmarch outdumb showmt. araratsea nymphgem statein commonswamp baypeat mossin demandpia materjoan miroold womanmain dragair medalon cameraii samuel
...View all with 8 letters...
Words (10037)
something15important13sometimes13somewhere17christmasapartment13screaming14emergency17gentleman12community18mountains11commander16treatment11committed16ambulance15extremely21agreement12statement11champagne19nightmare15emotional11equipment22miserable13septemberimpressed14committee15policeman15confirmed17honeymoon17communist15someplace15recommend16temporary16complaint15promotion13
...View all with 9 letters...
Phrases (1032)
mount fujismall beersmall boatmanila baycoffee mugboot makerby machinefilm makermorus albaworm wheelpast timessumming upold masterpaul simongall midgeadam smithtv monitortv newsmanbottom dogdebt limitadam's peaksmall gamepipe dreambottom rotminor termmt orizababackup manmt. everestgem cuttersmall shipmt. rainiermetric tonmodal verbman fridayin due time
...View all with 9 letters...
Words (9980)
completely19government16impossible16themselves18department15permission14punishment17impressive17atmosphere17mysterious15experiment21impression14commercial18medication15commission16determined14management15engagement14investment15commitment18remarkable18assignment13ambassador15importance16tournament12excitement21motorcycle19tremendous13instrument12retirement12performing18compliment18ultimately15compromise18compassion16
...View all with 10 letters...
Phrases (1372)
abel tasmanmarking inkmary leakeybombyx moripast masterblood serumcommon plummelting potcharm quarkpast simpleknut hamsunlookout manthorium-228lunar monthmagic spellwhite camasroot systemnoble metalfamily linelola montezmoshe dayanmt. mckinleyslim chancehall of famemt. st. helenssmall stuffmt. vesuviususs monitormaxim gorkysam shepardlie dormantmetric unitgenu valgumnimble willemery cloth
...View all with 10 letters...
Words (8597)
information16immediately19comfortable20grandmother18complicated20appointment17competition17performance20embarrassed16imagination14environment16temperature15development19complaining18magnificent19combination17communicate19documentary19businessman15supermarket19arrangement14maintenance15meaningless14importantly18sentimental13examination20replacement17demonstrate14remembering18humiliating17millionaire13fundamental17transformed17masterpiece17enforcement18
...View all with 11 letters...
Phrases (1671)
humphry davybarack obamamount elbertname droppergenus myxinegrass familysummer sweetlaying claimbeam of lightgenus crambeboxing matchfilm editingshort temperbill mauldinmarc chagallwilliam tellmighty mousegreat schismwalt whitmanpouched molebarrel makerbitter lemonmax delbruckmeat grindermesozoic eracomte de saxedrill mastersystem errorin agreementmagic bulletgeorge meadeincumbent onwormian bonemary shelleyadmiral byrd
...View all with 11 letters...
Words (6776)
embarrassing17commissioner18championship26announcement16accomplished24instrumental14transmission14compensation18confirmation19overwhelming24mademoiselle17unemployment21experimental23imprisonment18contemporary21contaminated17circumstance20metropolitan16humanitarian17michelangelochemotherapy27demonstrated16unimaginable17dramatically20manufactured20manipulation16manslaughter18mathematical21commissioned19manufacturer19intimidating16missionaries14commonwealth24manipulating17illegitimate15
...View all with 12 letters...
Phrases (1878)
carnauba palmrun-of-the-millgraham greenetrouble makerelihu thomsonmeasuring rodmortise jointmount everestplant hormonefilm directorplant kingdomgenus anethumbusiness firmcommon personserious musiclake michiganmalawi kwachamary magdalenmarcel breuerallium porrumbaal merodachmolly pitchermrs. henry woodgrain sorghumisamu noguchigeorge m. cohanarnold palmermary mccarthymock polo neckmarcel proustmount orizabaget one's lumpsslabbing millstar magnoliatenant farmer
...View all with 12 letters...
Words (4957)
circumstances21uncomfortable22entertainment15communication21demonstration16approximately29establishment20misunderstood17underestimate16environmental18automatically20misunderstand17embarrassment19determination16mediterranean16massachusettsenlightenment19communicating22encouragement18homosexuality28administrator16advertisement19manufacturing21compassionate19documentation18accommodation22fundamentally22multinational15mathematician22companionship24manifestation18contamination17extermination22comprehension22demonstrating17
...View all with 13 letters...
Phrases (2040)
john masefieldaleatory musicpaul hindemithfamily laridaeremovable diskjohn mccormackwilliam stubbsdirect antonymmight-have-beenmeasuring unitmeasuring wormmuscular tonusplant materialpouched mammalfull treatmentgilbert murraygrain merchantitalian milletjan swammerdammyrobalan plumfamily picidaein a similar waybedside mannermarcel duchampmount mckinleycharm campaignallium sativuminventory itembreathing timemarcel marceausystem commandananas comosusfilm projectorcommon raccoonfield marigold
...View all with 13 letters...
Words (3419)
administration17communications22disappointment21recommendation21transformation19pharmaceutical25simultaneously19discrimination19administrative20accomplishment27cinematography27circumstantial20systematically24understatement17fundamentalist20metaphorically26uncompromising23implementation20multiplication20impressionable20malfunctioning22democratically24overwhelmingly29excommunicated30criminalistics20contemporaries20sentimentality19mathematically26newspaperwoman26indiscriminate19discriminating20unpremeditated20meteorological19miscalculation20comprehensible25
...View all with 14 letters...
Phrases (2187)
family apiaceaefertilized ovumimperative formalpine clubmossnegeri sembilanimperative moodpearl mae baileyamphibole groupimperative verbmarc blitzsteingarageman's lienhumulus lupulusmuscular tissueclementine treelachrymal glandmultiflora rosetheodor mommsengalium odoratummoonseed familycount per minutesales agreementwilliam tindaleorder mysidaceawilliam tyndalemount parnassusgenus sargassumbarbara tuchmanbonasa umbellusdimethyl ketonefamily ardeidaemigration routedebt instrumentrenaissance manwalter lippmannmarkup language
...View all with 14 letters...
Words (2222)
electromagnetic22cinematographer25professionalism22experimentation26methamphetamine29acknowledgement28environmentally23decontamination20ophthalmologist26monounsaturated18disillusionment18spermatogenesis20unsportsmanlike23whatchamacallit30misapprehension24excommunication30democratization29sympathomimetic31lymphadenopathy34indemnification23schistosomiasis22bioluminescence23competitiveness24incompatibility26totalitarianism17sadomasochistic25discombobulated25pharmacological27uncommunicative26developmentally26cinematographic27impressionistic21oversimplifying29meaninglessness18photojournalism29
...View all with 15 letters...
Phrases (2186)
malaria parasitemeasuring deviceallium carinatumfelis domesticusdame muriel sparkoutside marriagecapital of gambiaalimentary pasteasamiya languagehelen wills moodymutatis mutandisdialysis machinestrait of malaccaconium maculatumfamily tinamidaestrait of messinamount nyiragongomrs. humphrey wardfamily lemnaceaecolumba fasciatafossorial mammalmanilkara zapotaallium tricoccumasarum europaeumbarbara w. tuchmanfamily arecaceaegenus gnaphaliumacheta assimilisbronze star medalacheta domesticamail-order buyingbessemer processsystem of weightsstuffed mushroomcommon roundworm
...View all with 15 letters...
Words (834)
misunderstandingincomprehensibleenvironmentalistindiscriminatelyelectromagnetismmultimillionairepheochromocytomaneurotransmittertransilluminatorunderdevelopmenthemorrhoidectomymisappropriationincomprehensiblyenvironmentalismmultidimensionalcounterterrorismtriphenylmethanenoncommunicationcircumambulatingdiscombobulationundernourishmentchemotherapeuticmicroelectronicsimperceptibilityuncompromisinglyelectromagneticsstereomicroscopeelectromyographymultidirectionalcircumstantiallypharmaceuticallysphygmomanometertrichotillomaniademineralizationpresumptuousness
...View all with 16 letters...
Phrases (1866)
hypodermic needletympanic membranemultiengine planecommedia dell'artebattle of marathonmanihot esculentadame kiri te kanawamalarial mosquitoin a beastly manneratopic dermatitisbattle of monmouthdelphinium ajacisstrait of magellanw. somerset maughamzirconium dioxidecartridge removerfamily cyperaceaebattle of omdurmanphotographic filmfamily cyprinidaebill of indictmentstephane mallarmewilliam wycherleycaptain james cookcaptain john smithcovering materialsermon on the mountchemical analysiscapital of jamaicaorder of magnitudeachillea ptarmicaamerican sycamorenerve compressioninstrumental roleturcoman language
...View all with 16 letters...
Words (500)
immunosuppressiontelecommunicationimmunosuppressivecommercializationmisinterpretationintergovernmentalmisidentificationimmunosuppressanttranscendentalismmisrepresentationelectrocardiogramcompartmentalizedparathyroidectomyreconstructionismmaterialisticallytransilluminationchemiluminescencecontemporaneouslycomprehensivenessthermodynamicallyincommunicabilitysocioeconomicallycompartmentalisedelectromechanicalmultidisciplinarydextroamphetamineuncomfortablenessnondenominationaldematerializationinterdepartmentalnonmathematiciansmiscommunicationscounterstatementsmiscomprehensionsthermoluminescent
...View all with 17 letters...
Phrases (1727)
william stricklandheat of sublimationmanihot utilissimadame margot fonteyngopherus polypemusmary leontyne pricemount godwin austencompetence hearingmount kanchenjungabalaena mysticetusclomiphene citratejohn moses browningczech monetary unitproteolytic enzymemespilus germanicarepublic of armeniasodium bicarbonatelycopodium alpinummary mcleod bethunepast-tense morphemehypoglycemic agentcuban monetary unithashimoto's diseasewilliam wordsworthbessemer converterdrag through the mudspecial assessmentfamily dasypodidaearchibald macleishasbestos abatementlycopus americanussemiconductor unitmiguel de cervantessarcorhamphus papasubphylum craniata
...View all with 17 letters...
Words (277)
telecommunicationscompartmentalizinganthropomorphizingpsychopharmacologyoversimplificationtransmogrificationspectrophotometrichyperaldosteronismdisenfranchisementpaleoclimatologistthermoluminescencespectrofluorometrymethyltestosteronecoccidioidomycosispolymorphonuclearsradiochromatogramscommensurabilitiesmisidentificationselectrodynamometercommercializationsmisinterpretationsthermoplasticitiesspectrophotometersmultifunctionalitynoncomprehensivelyinharmoniousnessesmisrepresentationscommunicablenessesrambunctiousnessesmonochromaticitiescompanionabilitiesdisintermediationssphygmomanometriesarchaeoastronomieslatitudinarianisms
...View all with 18 letters...
Phrases (1567)
hindu calendar monthabel janszoon tasmanbombycilla cedrorunbombycilla garruluswashington monumentgenus struthiomimusadministrative bodyamerican revolutiontuamotu archipelagodrafting instrumentphotographer's modelfamily physeteridaeanamnestic reactionorthotomus sutoriusdame sybil thorndikeandromeda polifolialachrymal secretioncapital of guatemalaadministrative unitperomyscus leucopuswet-bulb thermometerafghan monetary unitmusculospiral nerveimperfective aspectnavigational systemgeorge michael cohanmount rushmore statepodilymbus podicepsmoschus moschiferuscolumbia universitymary wollstonecraftelaeagnus commutataalpinia officinarumclass schizomycetesread-only memory chip
...View all with 18 letters...
Words (156)
hyperparathyroidismsternocleidomastoidpseudohermaphroditeelectroluminescencepneumoencephalogramcinematographicallyspectrofluorometricthermoluminescencesdisenfranchisementsthermoperiodicitiesspectrophotometriesparathyroidectomiessurface-assimilativecommunicativenesseshypolipoproteinemiacompanionablenesseshypoparathyroidismspostmillenarianismscompassionatenessesencephalomeningitismucopolysaccharidescomplementarinessessmall-capitalisationsmall-capitalizationcomprehensibilitiescomprehensivenessescounterdemonstratoranarcho-collectivismtransformationalistimmunocytochemistryimmunofluorescencesmagnetohydrodynamicimmunohematologicalmultitudinousnessespharmacodynamically
...View all with 19 letters...
Phrases (1234)
water-plantain familymeasuring instrumentbattle of marston moormuscular contractionallium cepa viviparumbronislaw malinowskifamily cyclopteridaerobert emmet sherwoodjohn millington syngesierra madre orientalfamily cynoglossidaeitalian monetary unitallium schoenoprasumlatvian monetary unitmillimeter of mercurycollective agreementmicromeria douglasiiphytolacca americanafamily lepisosteidaezairese monetary unitfamily dasyproctidaevertical combinationmeat-packing businessgenus symphoricarposbattle of saint-mihielgentlemen's agreementascaris lumbricoidesdecreasing monotoniczambian monetary unitcantabrian mountainsexecutive departmentstephen michael reichscomberomorus sierranancy freeman mitfordrepublic of guatemala
...View all with 19 letters...
Words (73)
compartmentalizationhypercholesterolemiaanthropomorphizationelectroencephalogramspectrofluorometriessemiautobiographicalradioimmunoassayableradiopharmaceuticalsspectrophotometricalparathyroidectomizedabetalipoproteinemiahyperadrenocorticismcomprehensiblenessescounterdemonstrationlymphogranulomatosestransformationalistsimmunocytochemicallylymphogranulomatosismagnetofluiddynamicsphenylpropanolaminesphenylthiocarbamidesimmunoprecipitationspseudohermaphroditicoophorosalpingectomyglomerulonephritidesneuropharmacologicalneuropharmacologistselectroluminescencesrepresentationalismsbuckminsterfullerenephosphomonoesteraseshyperlipoproteinemiamagnetohydrodynamicsdestructive-metabolichistoincompatibility
...View all with 20 letters...
Phrases (971)
william stanley jevonssweet-scented geraniumarcheological remainsallium cepa aggregatumhonduran monetary unitwyethia amplexicaulisorder mycelia steriliapara aminobenzoic acidabelmoschus moschatusdwarf flowering almondfamily phytolaccaceaephotographic emulsionmalawian monetary unitlebanese monetary unitwilliam wilkie collinsorder myxobacterialesmultilinear evolutionlunar excursion modulesir karl raimund popperfamily trachipteridaesecond coming of christindirect transmissiondouble-reed instrumentambloplites rupestrisdevelopmental anatomywalther hermann nernstmarchantia polymorphaclyde william tombaughfamily dermochelyidaecontradiction in termspierre simon de laplaceamphitheatrum flaviumscomberomorus cavallacardinal compass pointscomberomorus regalis
...View all with 20 letters...
Words (33)
psychopharmacologicalhypogammaglobulinemiadisestablishmentariancompartmentalizationsstereomicroscopicallymultidimensionalitiesimmunocytochemistriesconstructive-metabolicimmunoelectrophoresesimmunoelectrophoreticmucopolysaccharidosisestablishmentarianismpseudohermaphroditismelectroencephalogramscontemporaneousnessesmeningoencephalitideselectromyographicallybuckminsterfullerenesovercommercializationimmunoelectrophoresisanthropomorphizationsincomprehensibilitiespolyvinyl-formaldehydeantiauthoritarianismsarenaria-melanocephalacountercountermeasuremicrominiaturizationscounterdemonstrationsnondenominationalismsantiferromagneticallyundemonstrativenesseshypercholesterolemiaspsychopharmacologistsPhrases (747)
acrocentric chromosomesir john everett millaissierra madre occidentalabelmoschus esculentusadministrative hearingelimination tournamentdissolution of marriagesierra nevada mountainsexperimental conditionhelianthemum scopariumicelandic monetary unitanaphalis margaritaceadiametrical oppositionnikolai rimsky-korsakovmalaysian monetary unitanthriscus cereifoliumexecution of instrumentbattle of soissons-reimshelichrysum bracteatummusculus intercostalisligustrum obtusifoliumbulgarian monetary unitconfederate rose mallowanigozanthus manglesiibillie jean moffitt kingstephen william hawkingarchitectural ornamenthungarian monetary unitwolfgang amadeus mozartmultiplicative inversesri lankan monetary unitketorolac tromethaminepharmaceutical chemistliquefied petroleum gasconfession of judgement
...View all with 21 letters...
Words (15)
pentamethylenetetrazoldisestablishmentariansspectrophotometricallynonrepresentationalismimmunohistochemistriesintercomprehensibilitycarboxymethylcelluloseovercommercializationshexamethylenetetramineincomprehensiblenessesencephalomyocarditisescountercountermeasuresestablishmentarianismsmicrospectrophotometermicrospectrophotometryPhrases (516)
venezuelan monetary unitlycopersicon esculentumadministrative districtadministrative divisiongregorian calendar monthadministrative officialtransient global amnesiaschlumbergera truncatusredevelopment authorityhydrated aluminium oxidenavigational instrumentbarbara wertheim tuchmanleishmaniasis americanaherbert marshall mcluhanitalian vegetable marrowinstrument of punishmentequal-area map projectionfamily dendrocolaptidaemultiple mononeuropathyfoeniculum vulgare dulceuniform resource locatorsubfamily bassariscidaesodium tripolyphosphatebattle of the bismarck seaguatemalan monetary unitrhythm and blues musicianathyrium thelypteroidesenterobius vermiculariscapital of massachusettsmicropogonias undulatusconstructive metabolismapis mellifera adansoniimarcus vipsanius agrippamusculus triceps brachiifrancois charles mauriac
...View all with 22 letters...
Words (7)
nonrepresentationalismscarboxymethylcelluloseshexamethylenetetraminesdichlorodifluoromethanehypobetalipoproteinemiamicrospectrophotometersmicrospectrophotometricPhrases (395)
family threskiornithidaetransient ischemic attacktribasic sodium phosphatesecond battle of el alameingeorge macaulay trevelyanchlorpheniramine maleatemeperidine hydrochloridesubpoena ad testificandumelectromechanical devicetweedledum and tweedledeeaugust wilhelm von hofmannkazakhstani monetary unitpharmacological medicineapium graveolens rapaceumthiopentobarbital sodiumclassified advertisementsir william rowan hamiltoneuropean recovery programgottfried wilhelm leibnizkyrgyzstani monetary unithenri emile benoit matissebangladeshi monetary unitsouth korean monetary unittajikistani monetary unitgroup pteridospermaphytaintellectual nourishmentmcguffey eclectic readershydrophyllum virginianumsearch and destroy missionuzbekistani monetary unitwilliam cuthbert faulknernorman conquest of englandeastern malayo-polynesianchrysanthemum partheniumkingdom of the netherlands
...View all with 23 letters...
Words (8)
microgramma-piloselloideshyperbetalipoproteinemiaintercomprehensibilitiesphosphatidylethanolaminemicroelectrophoreticallydichlorodifluoromethanesmicrospectrophotometriesschizosaccharomycetaceaePhrases (271)
basque homeland and freedomcarnegie mellon universitylouis seymour bazett leakeypelham grenville wodehouseargyroxiphium sandwicensesubdivision deuteromycotasubphylum cephalochordatamary wollstonecraft godwinzollinger-ellison syndromeprimary sex characteristicsir terence mervyn rattiganbattle of the spanish armadadmitri ivanovich mendeleevarthur meier schlesinger jr.cucumis melo cantalupensisgottfried wilhelm leibnitzcommonwealth of the bahamasalexandre emile jean yersinapocynum androsaemifoliummagnetic resonance imagingantiarrhythmic medicationmatricaria matricarioidesinternal-combustion enginerichard buckminster fulleralfred edward woodley masontechnology administrationeconomic and social councilgovernment printing officecomprehensive examinationgerman democratic republicfederal republic of germanycreating from raw materialsmohorovicic discontinuitycharles camille saint-saensmartha beatrice potter webb
...View all with 24 letters...
Words (3)
immunoelectrophoreticallyphosphatidylethanolaminesantiestablishmentarianismPhrases (198)
embryonal rhabdomyosarcomamyroxylon balsamum pereiraecosmic microwave backgroundmary wollstonecraft shelleymiguel de cervantes saavedradiamond wedding anniversarymusculus quadriceps femorisbattle of the chemin-des-damessymphoricarpos orbiculatuschemical weapons conventioncruel and unusual punishmentbrassica oleracea gemmiferadistinguished service medalfriedrich wilhelm nietzschemodest petrovich mussorgskyedmund john millington syngesternocleidomastoid musclepolystichum acrostichoidesmelanerpes erythrocephalusamerican baptist conventionbeggar-my-neighbour strategysaddam bin hussein at-takritithermoelectric thermometercaulophyllum thalictroidesherpes simplex encephalitisfood and drug administrationeigenvalue of a square matrixtrans-alaska pipeline systemmichelson-morley experimentcharles frederick menningerbaron alexander von humboldtwestern samoan monetary unitmonoamine neurotransmittercommand processing overheadsuborder petromyzoniformes
...View all with 25 letters...
Phrases (160)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanbattle of monmouth court housex-linked dominant inheritanceconfederate states of americabacon-lettuce-tomato sandwichpolicing and enforcement costdorothy mary crowfoot hodgkinmalignant neoplastic diseaseadrenocorticotropic hormonepersonal information managerjames abbott mcneill whistlerhuman immunodeficiency virussubmandibular salivary glandstandard anatomical positiondepartment of transportationemployee stock ownership planunited arab emirates's capitaltrespass quare clausum fregitgeorg wilhelm friedrich hegeljean-auguste-dominique ingresandrei dimitrievich sakharovassyrian neo-aramaic languagecharles maurice de talleyrandus government printing officerevolutionary calendar monthclement philibert leo delibesantipernicious anemia factorgeorge iv of the united kingdomsubdivision basidiomycotinasubdivision deuteromycotinaindirect immunofluorescencesubdivision mastigomycotinabureau of diplomatic securitysystem of weights and measures
...View all with 26 letters...
Words (1)
ethylenediaminetetraacetatePhrases (114)
business environment analysisamerican revolutionary leaderholy roman emperor frederick iiorder of our lady of mount carmelelectromechanical transduceroffice of management and budgetsolenostemon scutellarioidesaugustus welby northmore pugintransmission control protocolfreedom from search and seizurecommissioned military officerelectronic musical instrumentnuclear regulatory commissionjerusalem artichoke sunflowerpull the wool over someone's eyestriticum dicoccum dicoccoidesadrenocorticotrophic hormonedeoxyadenosine monophosphatesecretary of commerce and laborsocial development commissiondeoxythymidine monophosphatejames augustine aloysius joycepositive reinforcing stimulusthyrotropin-releasing hormonehomo sapiens neanderthalensisbaron lloyd webber of sydmontoninformation processing systemsir frederick william herschelthrough empirical observationaquilegia scopulorum calcareasmall business administrationrodion romanovich raskolnikovgeorge iii of the united kingdommachaeranthera tanacetifoliatheodore herman albert dreiser
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (106)
interstate commerce commissionmarcus junius brutus the youngerstrategic arms limitation talksfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskycardiopulmonary resuscitationmicrosoft disk operating systemcommission on the status of womencapital of serbia and montenegrocucurbita maxima turbaniformisdemocratic republic of the congocriminal investigation commandfederal housing administrationfeodor mikhailovich dostoevskifeodor mikhailovich dostoevskydepartment of homeland securitymaster of arts in library sciencevladimir vladimirovich nabokovsergei mikhailovich eisensteindissident irish republican armyfrederick william iii of prussiarevolutionary communist leagueadministrative data processingface-amount certificate companyrevolutionary proletarian armysmall computer system interfacesodium carboxymethyl celluloseamerican staffordshire terriercoronoid process of the mandiblecygnus columbianus columbianusmillion instructions per secondsingle nucleotide polymorphismimperial japanese morning gloryorganization of american statesaspidophoroides monopterygius
...View all with 28 letters...
Words (1)
methylenedioxymethamphetaminePhrases (71)
business environmental analysischemical decomposition reactionmale internal reproductive organfriedrich wilhelm august froebeldmitri dmitrievich shostakovichautomatic data processing systemcombination in restraint of tradecapital of the dominican republicsao thome e principe monetary unitscrutin uninominal voting systeminternational olympic committeemiddle east respiratory syndromeferdinand joseph la menthe mortonunited arab emirate monetary unitbaron de la brede et de montesquieudisseminated multiple sclerosiskatmai national park and preservehydrangea macrophylla hortensislydia kamekeha paki liliuokalanipresident william henry harrisonrene antoine ferchault de reaumurnational intelligence communityelectron paramagnetic resonancegeorges joseph christian simenoncomplex instruction set computerreduced instruction set computertheory of punctuated equilibriumtripleurospermum tchihatchewiifyodor mikhailovich dostoyevskyanonymous file transfer protocolpressure-feed lubricating systemlauritz lebrecht hommel melchiorelectronic simulative deceptioncombined transport bill of ladinggeneral services administration
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (50)
valentina vladmirovna tereshkovamusculus sternocleidomastoideusreduced instruction set computingglutamic oxalacetic transaminaseobsessive-compulsive personalitydepartment of energy intelligencevicomte ferdinand marie de lessepsethylenediaminetetraacetic acidaleksandr mikjailovich prokhorovbalance of international paymentsmultiple correlation coefficientaugust friedrich leopold weismannwaterhouse-friderichsen syndromesevere acute respiratory syndromesevere combined immunodeficiencyalessandro di mariano dei filipepipolymonium caeruleum van-bruntiaehyperbilirubinemia of the newborncalymmatobacterium granulomatismusculus transversalis abdominiscomplex instruction set computingplasma thromboplastin antecedentmucocutaneous lymph node syndromefrancois maurice marie mitterrandesther hobart mcquigg slack morrishenri rene albert guy de maupassantdag hjalmar agne carl hammarskjoldalfred charles william harmsworthsisters of st. michael the archangelarticulatio temporomandibularis1st viscount montgomery of alameinpositional representation systemmarie charlotte carmichael stopesmotion with variable accelerationmarie jean antoine nicolas caritat
...View all with 30 letters...
Phrases (46)
great smoky mountains national parkfreedom from involuntary servitudemarie louise elisabeth vigee-lebrundigital communications technologypetroselinum crispum neapolitanumunited states department of defensetupac amaru revolutionary movementsir john frederick william herschelmanipulative electronic deceptioninterstitial plasma cell pneumoniaanicius manlius severinus boethiuselectromotive drug administrationprimary subtractive color for lightislamic great eastern raiders-frontgeorges eugene benjamin clemenceauislamic jihad movement in palestinemaxwell-boltzmann distribution lawfemale internal reproductive organpremature ventricular contractionglutamic oxaloacetic transaminaseelectronic manipulative deceptionwernher magnus maximilian von brauncommonwealth of independent statesrecombinant deoxyribonucleic acidmaria luigi carlo zenobio cherubininicotinamide adenine dinucleotiderichard august carl emil erlenmeyerseptobasidium pseudopedicellatumfederal communications commissioninternational atomic energy agencymarie anne charlotte corday d'armontmarie dolores eliza rosanna gilbertarmenian apostolic orthodox churchcharles andre joseph marie de gaullemarine corps intelligence activity
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (39)
nikolai andreyevich rimski-korsakovafrican american vernacular englishpeople against gangsterism and drugspatent and trademark office databasedepartment of the federal governmenthierarchical classification systemweakly interacting massive particleintercontinental ballistic missilestraight-line method of depreciationobject-oriented programing languagenikolai andreyevich rimsky-korsakovsodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory drugisidore auguste marie francois comtemarcus aurelius valerius maximianusprimary subtractive colour for lightketosis-resistant diabetes mellitusinsulin-dependent diabetes mellituscockcroft-walton voltage multiplierroberto francesco romolo bellarmineelectronic counter-countermeasuresedmond louis antoine huot de goncourtoculopharyngeal muscular dystrophylymphocytic choriomeningitis viruswilhelm apollinaris de kostrowitzkityrannus domenicensis domenicensisprogressive emphysematous necrosiselectronic warfare-support measuresdemocratic people's republic of koreafederal emergency management agencynecrobiosis lipoidica diabeticorumbosnian-herzegovinian monetary unitchrysanthemum coronarium spatiosumadult respiratory distress syndromeamaranthus hybridus erythrostachys
...View all with 32 letters...
Phrases (34)
characteristic root of a square matrixmusical instrument digital interfaceautonomous sensory meridian responseinternational maritime organizationstandard generalized markup languageepistle of paul the apostle to philemonlycopersicon esculentum cerasiformeobject-oriented programming languagemusculus abductor digiti minimi manusmusculus abductor digiti minimi pedisbureau of alcohol tobacco and firearmsmusculus obliquus externus abdominispityrogramma calomelanos aureoflavaprivilege against self incriminationmusculus sphincter ductus choledochilaser-assisted in situ keratomileusisgeneral agreement on tariffs and tradefinancial crimes enforcement networkdisease of the neuromuscular junctionmercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceseconomic commission for latin americainternational law enforcement agencycapital: critique of political economypositron emission tomography scanneridiopathic thrombocytopenic purpurasomatic cell nuclear transplantationharakat al-jihad al-islami al-filastiniamaranthus hybridus hypochondriacusunited self-defense forces of colombiahimantopus himantopus leucocephalusdefense technical information centerunited states intelligence communityPhrases (29)
jacques francois fromental elie halevyrelational database management systemchronic obstructive pulmonary diseasefederal islamic republic of the comorosfederal national mortgage associationacademy of television arts and sciencesepistle of paul the apostle to the romansgeorge louis palmella busson du mauriernero claudius caesar drusus germanicuscosmic microwave background radiationinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticikolmogorov's strong law of large numberseuropean law enforcement organisationfunctional magnetic resonance imaginghermann ludwig ferdinand von helmholtzclostridium perfringens epsilon toxinfour-stroke internal-combustion engineprince otto eduard leopold von bismarckmassachusetts institute of technologyeconomic and social council commissionfederal home loan mortgage corporationerasable programmable read-only memorydepartment of health and human servicesbaron hugh caswall tremenheere dowdingmovimiento revolucionario tupac anarugymnosporangium juniperi-virginianaecomputerized axial tomography scannerrevolutionary armed forces of colombiaPhrases (23)
national baseball hall of fame and museumnational technical information servicecommunications security establishmentinternational development associationrevolutionary organization 17 novembercomte donatien alphonse francois de sadeimmaculate conception of the virgin marymaxmillien marie isidore de robespierrehereditary motor and sensory neuropathycockcroft and walton voltage multipliernational socialist german workers' partychristopher william bradshaw isherwoodimmigration and naturalization serviceanti-imperialist international brigadequintus septimius florens tertullianusfederal democratic republic of ethiopiafederal law enforcement training centerdepartment of defense laboratory systemballistic missile defense organizationnon-insulin-dependent diabetes mellitusfraxinus pennsylvanica subintegerrimasecurity intelligence review committeeproduct-moment correlation coefficientPhrases (16)
jakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorjuan carlos victor maria de borbon y borbonfield-sequential color television systemfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewiialbert francis charles augustus emmanueltransportation security administrationcriminal intelligence services of canadatiberius claudius drusus nero germanicussocialist people's libyan arab jamahiriyabaron karl maria friedrich ernst von weberdeclining balance method of depreciationpublius cornelius scipio africanus majorunited states government printing officePhrases (17)
severe combined immunodeficiency diseasefirst epistle of paul the apostle to timothyal-jama'a al-islamiyyah al-muqatilah bi-libyatheodore roosevelt memorial national parkketoacidosis-resistant diabetes mellituscentre for international crime preventiondemocratic and popular republic of algeriademocratic socialist republic of sri lankatrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and sciencesdepartment of health education and welfarekarl friedrich hieronymus von munchhausenus army criminal investigation laboratorysupreme headquarters allied powers europeunited states national library of medicinePhrases (10)
united states government accounting officeobject-oriented database management systemsecond epistle of paul the apostle to timothyalexis charles henri maurice de tocquevilledemocratic republic of sao tome and principeeconomic commission for asia and the far eastmarie joseph paul yves roch gilbert du motierdepartment of housing and urban developmentadvanced research and development activityminimally invasive coronary bypass surgeryPhrases (7)
million floating point operations per seconddefense reutilization and marketing serviceislamic jihad for the liberation of palestinerespiratory distress syndrome of the newbornfuerzas armadas revolucionarios de colombiabaron hermann ludwig ferdinand von helmholtzenzyme-linked-immunosorbent serologic assayPhrases (8)
revolutionary organization of socialist muslimsnational oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systemPhrases (6)
international bank for reconstruction and developmentnineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutioneighteenth amendment to the united states constitutionunited nations international children's emergency fundroyal society of london for improving natural knowledge
