Words Containing: K,H
(In Any Order)
There are 4,626 words,
2,449 phrases and
10 abbr's with
K,H in.
Best Scoring Words With: K,H
More words | |||||||
---|---|---|---|---|---|---|---|
Rank | Word | Save? | Length | Usage | Points | Type | |
1 | kolkhoz | 7 | 27 | nounn | |||
2 | sovkhoz | 7 | 26 | nounn | |||
3 | kolhozy | 7 | 26 | nounn | |||
4 | muzhiks | 7 | 25 | nounn | |||
5 | muzhik | 6 | 24 | nounn | |||
6 | kajawah | 7 | 24 | ||||
7 | hijacks | 7 | 23 | verb, nounv, n | |||
8 | khazens | 7 | 23 | nounn | |||
9 | hijack | 6 | 22 | verb, nounv, n | |||
10 | kvetchy | 7 | 22 | adjectiveadj | |||
or scroll down to see all results... | |||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (317)
thanks13knight14hooked14shrink13hockey18whisky19sketch15cheeky18shaken13sheikh16hiking14choked16hacker15kosher13kimchi17hijack22kahuna13chucky20chunky18chakra15shrunk13chokes15shaker13whacko18mohawk18shucks15hickey18shriek13kazakhshekel13khalsashrank13kyushuunhook13harken13
...View all with 6 letters...
Phrases (5)
hook onhook uphike uphex keyhack onWords (558)
chicken18kitchen16checked19shocked17shaking15whiskey20turkishkrishnachoking17shankarketchup18chuckle18whacked20lakshmihacking17hawkinshooking15schmuck20hawking18shekels14kashmir16thinker14rethink14kurdishhopkinscheckup20hammock20sketchy19shylock19shocker16karachihancockpushkinkeyhole17checker18
...View all with 7 letters...
Phrases (28)
tax hikedog hookhot cakecup hookko punchchock upthink ofthink uphome keyhen hawkchoke upwar hawkham hockchalk upbok choibok choyash cakechirk uphack sawpak choithe likemusk hogmake hayhawk owlsilk hatshack upholm oakwhisk byWords (754)
thinking16homework20shocking18workshop20thankful18paycheck24oklahomacheckers19sherlock17homesick19rickshaw20helsinkihokkaidoskinhead16whiskers18cherokeebookshop19haystack20skylight19ticklish17chipmunk21checkout19whacking21yokohamahandbook18hallmark17pachinko19hijacker24backhand20kerchief20bulkhead18kandaharshackled18archduke18hanukkah
...View all with 8 letters...
Phrases (94)
cant hookwhole kittalk showchoke offblack ashchalk outthank youark shellhold backball hawkreap hookcheck outwork shoetake a hopbank shotbed checkmilk wheyjohn knoxfish cakefish hawkcub sharkfire hookhash markheat sinkshake offtank shipmeat hookhot stocktom hanksshun gikufish tankbrash oakjohn rockholy weekhuck finn
...View all with 8 letters...
Words (860)
chuckling21stockholmcockroach22sheldrake17handshake20shrieking17skinheads17hitchcockbirthmark20checkmate22horseback20shrinking17housework19hijacking26humankind19yorkshireshipwreck23flashback23checkbook26hunchback25pinchbeck24blockhead21toothpick20thickness18locksmith20hitchhike24handiwork20milkshake22checkroom22checklist20bookshelf21shoemaker18childlike19makeshift21akhenaten
...View all with 9 letters...
Phrases (160)
louis kahntank shellchurch keydisk shapehip pocketthink backjohn spekecock-a-hoopsketch mapsketch outh. l. menckenrain checkchoke backchoke holdchalk talksick berthhave a lookbook clothfight backant shrikecheck overcheck stubphone jackrock hyraxsay hey kidmake happytrunk hosekarl barthback toothmilk shakepoker chipbench markthomas kyddark horsenorth peak
...View all with 9 letters...
Words (714)
earthquake26blacksmith23chopsticks23checkpoint23heartbreak19thankfully23cheesecake21kazakhstancheapskate21schoolwork22likelihood18shopkeeper21workaholic22matchmaker23bolsheviks22hitchhiker25jackhammer30khrushchevsteakhouse17shockingly23kieselguhr18hitchhiked26knighthood22watchmaker24rethinking18chickenpox30sketchbook25paddywhack29chalkboard22housebroke19heatstroke17aftershock22nightstick20smokehouse19freakishly23
...View all with 10 letters...
Phrases (185)
off-the-rackhard workercharm quarkknut hamsunrobert kochstrike hardgenus khayashish kebabchicken runthink twicephrase bookpigeon hawkjohnny cakeherman woukklieg lightjakob bohmeout of whacktoxic shocksneak thiefblack deathhook and eyerake handlerock pythonblank shellchess clocktake hold ofcheek pouchknit stitchbook of ruthcatch a winkstick shifttake the airmonk's clothtack hammerbunker hill
...View all with 10 letters...
Words (526)
shakespearehousekeeper20heartbroken20hardworking23unthinkable20knucklehead25hitchhiking27hypermarket25tchaikovskytutankhamunmatchmaking25huckleberry25leeuwenhoekkalashnikov25workmanship25stockholder21honeysuckle23baryshnikovtutankhamenunshakeable20handshaking23speechmaker24nightwalker22neckerchief25backstretch24bucktoothed23kitchenette20housebroken20hunchbacked28shuttlecock22kindhearted20hypokalemia25weathercock25monkeyshine23hypokalemic27
...View all with 11 letters...
Phrases (232)
tribal sheikcrank handlerobert hookehockey coachchock-a-blockdasht-e-kavirsketch blocklike thunderbluish blackshell jacketbilly the kidtalking headwhite knightpatch pocketalkyl halideturkish bathgreek choruscrushed rockfrank harristightly knitlock chamberjohan kepleranton chekovhenrik ibsenthird sackerup to his neckhooded cloakblack cohoshking husseinbank charterhealth checkravi shankardanish kronetake a breathtake a chance
...View all with 11 letters...
Words (331)
thanksgiving24handkerchief28breakthrough25breathtaking22housekeeping22heartbreaker21electroshock23thessalonikispeakerphone23marksmanship25speechmaking26homesickness23freethinking23shostakovichczechoslovakcockfighting28saskatchewanhyperkalemiapackinghouse24thankfulness22checkerboard26headshrinker23swashbuckler26hyperkinetic26earthshaking23unthinkingly23bushwhacking30backlighting25stakhanovite22unlikelihood20countercheck25poikilotherm23checkerberry28housebreaker21holidaymaker25
...View all with 12 letters...
Phrases (219)
tribal sheikhlake michiganmalawi kwachacaptain hickscounter checkhockey clinicshaking palsyhockey leaguekitchen rangenorthern pikekitchen stovemosquito hawkshelf bracketicing the puckchicken sexerernst haeckelchicken stockhunger strikejohn van vleckarrester hookgeorgi zhukovmerchant bankjockey shortshunting knifehorse blanketblight cankergreek drachmabrown hickoryanton chekhovblack catechurhesus monkeya. noam chomskycricket matchstock epithetcherokee rose
...View all with 12 letters...
Words (189)
heartbreaking23laughingstock24thunderstruck23shakespeareanbackscratcher28brokenhearted23phytoplankton27leatherjacket29swashbuckling28kaffeeklatsch32housebreaking23radhakrishnanchameleonlike24psychokinetic29shakespearianbrinksmanship26psychokinesis27holidaymakers26counterchecks26spaghettilike23knuckleheaded28headshrinkers24handkerchiefs29blacksmithing27swashbucklers27housebreakers22phytoplankter27jackhammering34breakthroughs26thunderstrike21kittenishness20gemutlichkeit25lockstitching25thanklessness20thanksgivings25
...View all with 13 letters...
Phrases (227)
el iskandriyahjohn mccormackwhite backlashbitter hickorytomato ketchupjekyll and hydezambian kwachachicken littlechicken manurechristmas caketelephone jackjohn steinbeckhatchback dooremile durkheimblack-and-whitekong the mastershock absorberthank offeringhigh-water markdorothy parkerthree kings' daytongue-in-cheekclothes basketjaroslav hasekbuckwheat cakescotch pancakenorfolk wherrykhmer languagerichard leakeychesapeake bayknight templarthomas a becketabraham stokerfrench pancakebook of obadiah
...View all with 13 letters...
Words (89)
czechoslovakiastraightjacket31chickenhearted29unthankfulness24unthinkability26omphaloskepsis27hyperkeratotic28leukodystrophy30blacksmithings28omphaloskepses27housebreakings24phytoplankters28skittishnesses21laughingstocks25thankfulnesses24breathtakingly27brackishnesses25hyperkeratoses26hyperkeratosis26earthshakingly28trickishnesses23prankishnesses23heterokaryoses24heterokaryosis24counterchecked28heterokaryotic26thrombokinases25shuttlecocking26checkerberries27brinksmanships27handkerchieves30keratinophilic25poikilothermic27ticklishnesses23halterbreaking24
...View all with 14 letters...
Phrases (219)
weather outlookanthony van dyckanthony vandykesir joseph banksdimethyl ketoneischemic strokekitchen cabinetblackberry bushmikhail bakunindogstooth checkstephen hawkingaround-the-clockstephen leacockkazakh languageblended whiskeychicken scratchkechua languagehong kong dollarfriedrich krupparthur koestlerhendrik lorentzturkish capitalpatchwork quiltturkish delightblackwall hitchsouth korean wonkhabarovsk kraimeister eckhartup to their neckssouth yorkshirebuckthorn berryneck of the woodsjohannes keplerhans adolf krebshorseback rider
...View all with 14 letters...
Words (59)
czechoslovakianheartbreakingly28kindheartedness24kinesthetically27counterchecking29kaffeeklatsches34childlikenesses25thunderstricken25thunderstriking24thanklessnesses22phenylketonuric29straightjackets32cholecystokinin29pharmacokinetic30lickerishnesses24microearthquake35phytoplanktonic31thinkablenesses24phenylketonuria27heartsicknesses24kittenishnesses22thankworthiness28brokenheartedly28chondroskeleton25backscratchings31chicken-breastedkind-heartednessthickheadedness29blockheadedness28lymphoblast-likehuckleberryings30poikilothermousepikeratophakiaspanish-speakingenglish-speaking
...View all with 15 letters...
Phrases (192)
in all likelihoodnikolai bukharinpinchas zukermansnake in the grasskechuan languagewholesale marketmountain hemlocktragulus kanchilturkish languagehooded sheldrakedag hammarskjoldkhalkha languagegustav kirchhoffbuckthorn familyhorseback ridingalfred hitchcockcommon blackfishhakea leucopteraniels henrik abelhomework problemruholla khomeinikingdom of bhutanhookworm diseasest. thomas a becketwishful thinkingtaras shevchenkosparkplug wrenchhawksbill turtleneedle spike rushwild bill hickockcornhusker stateshrinking violetbasketball coachelectrical shocklogical thinking
...View all with 15 letters...
Words (16)
heterokontophytaleukodystrophiesunthinkabilitiesthought-provokingkinaestheticallypharmacokineticsstraightjacketedphenylketonuriasphenylketonuricsdneprodzerzhinskdniprodzerzhynskbrownish-speckledheterokaryosisesmicroearthquakescholecystokininskrypterophaneronPhrases (153)
throw out of kilterhypophyseal stalkalan lloyd hodgkingeorge walker bushshortbread cookiearam khachaturianalexander pushkinhoundstooth checkdisease of the skinfrank lloyd wrightark of the covenantwest coast hemlockelwyn brooks whitekhirghiz languageobstructive shockkingdom of lesothocreative thinkingbelted kingfisherblock anaesthesiamove back and forthkingston-upon hulldivergent thinkerjohn hope franklinkashmiri languagethick-billed murrecoral honeysucklelighthouse keeperknow what's going onnorth-seeking polekatharine cornelllouis isadore kahnkatherine cornellhelen adams kellerhelen hunt jacksonsir john cockcroft
...View all with 16 letters...
Words (7)
triskaidekaphobialeukoencephalitiskindheartednessesstraightjacketingtriskaidekaphobicthreskiornithidaebrokenheartednessPhrases (146)
katsushika hokusaimount kanchenjungakiswahili languageshipwreck survivorhorned rattlesnakeabkhasian languagecapital of oklahomachinookan languagesackcloth and ashesrudolf karl virchowburning at the stakejaroslav heyrovskyoncorhynchus nerkahook line and sinkerhenry louis menckenfrench honeysuckleconvergent thinkersir anthony hopkinscharles f. ketteringdivergent thinkingbooker t. washingtonmark the evangelistoff the beaten trackheinrich von kleistjohn maynard keynesdwarf chinkapin oakal-hakim bi-amr allahcivil rights workerlouis the wideawakechickasaw languagecharred pancake cupswallow-tailed hawksympathetic strikechicken cacciatorahub-and-spoke system
...View all with 17 letters...
Words (2)
triskaidekaphobiaspocket-handkerchiefPhrases (105)
dame sybil thorndikebackspace characterkamchatka peninsulaalkaline-earth metalstinking nightshadecalifornia white oakdmitri shostakovichthanksgiving cactuscakchiquel languageanton van leuwenhoekhablot knight brownecyrus hall mccormickkarl friedrich gaussedward lee thorndikeanagasta kuehniellacharles follen mckimbreak someone's heartkarl wilhelm scheelesir frederick ashtonandrew dickson whiteathapaskan languagekatherine mansfieldwilliam shakespearedwarf chinquapin oakhindu kush mountainsbottlebrush buckeyeeurasian kingfisheritalian honeysucklearches national parkherbert clark hooverkalashnikov cultureheat-seeking missilealeksandr pavlovichnikolai lobachevskyaleksandr prokhorov
...View all with 18 letters...
Words (2)
phosphofructokinasemakataimeshekiakiakPhrases (87)
shakespearean sonnethandle with kid glovescapital of kazakhstancalifornia buckthornvalentina tereshkovajapanese honeysucklecapital of north koreacapital of south koreagerard manley hopkinsanton van leeuwenhoekout-of-the-box thinkingdibranchiate molluskcapital of the ukrainenetwork architecturemickey charles mantlewhite-leaved rockrosemartin luther king daybattle of chickamaugakate o'flaherty chopinkatherine anne portergeorge hubert wilkinsembryoma of the kidneynorthern cricket froglepidothamnus fonkiihard-skinned puffballredheaded woodpeckeredgeworth-kuiper beltshirodkar's operationkayser-fleischer ringwhole kit and caboodleskeleton in the closetchocolate chip cookieswamp fly honeysucklecalifornia buckwheaternst ludwig kirchner
...View all with 19 letters...
Words (1)
phosphofructokinasesPhrases (65)
black-capped chickadeeyellow-shafted flickerstephen butler leacockfriedrich alfred krupprepublic of kazakhstanernst heinrich haeckelmechanically skillfulcapital of north dakotahendrik petrus berlageklemens von metternichhugo alvar henrik aaltocapital of south dakotaanton pavlovich chekovrocky mountain bighornjohn kenneth galbraithdwarf golden chinkapinpsychopsis kramerianahemlock water dropwortevergreen huckleberrychinese black mushroommetrazol shock therapynerve block anesthesianorthern pocket gopherbluethroat pikeblennymikir-meithei languagesnake's head fritillaryemil klaus julius fuchsengelbert humperdinckeuropean house cricketarthur jacob arshawskyhexalectris warnockiihendrik antoon lorentzenglish cocker spanielwilhelm konrad rontgenkinetic theory of gases
...View all with 20 letters...
Phrases (70)
igor ivanovich sikorskyaleksandr solzhenitsynstephen william hawkingketorolac tromethaminesmallmouthed black bassaram ilich khachaturiankonrad zacharias lorenzanton pavlovich chekhovantonie van leeuwenhoekknight of the round tablecharles frederick worthjohn fitzgerald kennedythomas jonathan jacksonthomas kennerly wolfe jr.william schwenk gilbertsir john cowdery kendrewpresident john f. kennedyschlumbergera buckleyiamerican stock exchangenerve block anaesthesiathin-leaved stringybarkbabe didrikson zahariasketamine hydrochloridewinter crookneck squashskeleton in the cupboardgreater prairie chickenfriedrich august kekuleoriental black mushroomgenus krypterophaneroninsulin shock treatmentpeter ilich tchaikovskytennessee walking horselymphoblastic leukemiawilhelm konrad roentgenharkat-ul-jihad al-islami
...View all with 21 letters...
Phrases (46)
gilbert keith chestertonaleksandr i. solzhenitsynjohn ronald reuel tolkienfrancis richard stocktonbattle of the bismarck seajohns hopkins universityroman osipovich jakobsonjohn davison rockefellerpyotr ilyich tchaikovskyalpha-adrenergic blockerblack-crowned night heroncharlotte perkins gilmanblack-fronted bush shrikehot springs national parksubdivision ginkgophytahydraulic brake cylindermetrazol shock treatmentarchidiskidon imperatormikhail ivanovich glinkaplantation walking horseernestine schumann-heinkeuropean fly honeysucklehendrik frensch verwoerdboris vasilevich spasskyshenandoah national parkfrank winfield woolworthbuckleya distichophyllaarcuate vein of the kidneyblack english vernacularburrhus frederic skinnerfirst duke of marlboroughthree-spined sticklebacksaddle block anaesthesiachesapeake bay retrievermatthias jakob schleiden
...View all with 22 letters...
Phrases (45)
family threskiornithidaetransient ischemic attacknikolai vasilievich gogolkazakhstani monetary unitchristoph willibald glucksarvepalli radhakrishnandorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorwilliam cuthbert faulknerkingdom of the netherlandssir anthony philip hopkinsyuri alekseyevich gagaringeorge herbert walker bushragnar anton kittil frischsir john douglas cockcroftmammoth cave national parkmikhail ivanovich kalininbattle of the caudine forksfriedrich august von hayektheory of weak interactionwernicke's encephalopathybraxton-hicks contractionvirginia katherine mcmathdual inline package switchdomenikos theotocopoulospink-and-white everlastingwilliam bradford shockleytrofim denisovich lysenkocyril northcote parkinsonhypertext mark-up languagehypertext markup languagephonograph recording diskbecker muscular dystrophysir frederick handley page
...View all with 23 letters...
Phrases (29)
division heterokontophytarichard buckminster fullerbahasa kebangsaan languagecharles john huffam dickensandrei andreyevich gromykohashemite kingdom of jordansubdivision ginkgophytinamaxfield frederick parrishnikolai ivanovich bukharinaleksey maximovich peshkovfrancis henry compton crickbattledore and shuttlecockanatoli yevgenevich karpovjohann joachim winckelmannarcuate artery of the kidneysoutheastern pocket gopherlucy in the sky with diamondsmohandas karamchand gandhihuman t-cell leukemia virus-1domesticated silkworm mothayatollah ruholla khomeinicharles christopher parkerdavid lewelyn wark griffithcharles franklin kettering4.5-inch beach barrage rocketacute lymphocytic leukemianaked as the day you were bornkatharine houghton hepburnkund johan victor rasmussenPhrases (26)
igor fyodorovich stravinskyboris leonidovich pasternakmodest petrovich mussorgskyrudolf christian karl dieselsaddam bin hussein at-takritipyotr alexeyevich kropotkincharles frederick menningerandrei arsenevich tarkovskymelville louis kossuth deweyangus frank johnstone wilsonaleksey maksimovich peshkovmikhail yurievich lermontovsecond marquis of rockinghamchamaecyparis nootkatensiscapital of the united kingdomvon recklinghausen's diseasechronic myelocytic leukemiafederal home loan bank systemhenry kenneth alfred russellcommunist party of kampucheabruckenthalia spiculifoliarashtriya swayamsevak sanghnorth cascades national parkwilliam makepeace thackeraybranched chain ketoaciduriakeratoderma blennorrhagicaPhrases (29)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkx-linked dominant inheritancesir sarvepalli radhakrishnandorothy mary crowfoot hodgkinemployee stock ownership planbooker taliaferro washingtonandrei dimitrievich sakharovgeorge iv of the united kingdommikhail ilarionovich kutuzovfriedrich gottlieb klopstockchristoph willibald von gluckalexander alexandrovich blokparty of democratic kampucheamodest petrovich moussorgskykeep one's shoulder to the wheeljohannes diderik van der waalsfirst baron marks of broughtonchronic lymphocytic leukemialiters per hundred kilometerssir frederick gowland hopkinssergei sergeyevich prokofievbaron richard von krafft-ebingacute lymphoblastic leukemiabaroness jackson of lodsworthbaroness thatcher of kestevenlitres per hundred kilometreskathleen mansfield beauchampPhrases (28)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkindirector-stockholder relationjerusalem artichoke sunflowertaras grigoryevich shevchenkosir frederick william herschelrodion romanovich raskolnikovgeorge iii of the united kingdomaleksandr aleksandrovich bloknikolai ivanovich lobachevskyaleksandr porfirevich borodinx-linked recessive inheritancemikhail sergeyevich gorbachevkazimir severinovich malevichgeorgi konstantinovich zhukovrudbeckia laciniata hortensiakeep one's nose to the grindstonejohannes evangelista purkinjehawai'i volcanoes national parkhawaii volcanoes national parkindustrial workers of the worldmujahidin-e khalq organizationmartin luther king jr's birthdaywilliam iv of the united kingdombaron karl wilhelm von humboldtmaurice hugh frederick wilkinssclerosing leukoencephalitisPhrases (15)
aleksandr feodorovich kerenskyfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskifeodor mikhailovich dostoevskyvladimir vladimirovich nabokovsergei mikhailovich eisensteincount lev nikolayevitch tolstoymikhail aleksandrovich bakuninmildred ella didrikson zahariasgates of the arctic national parkkonstantin sergeevich alekseevfirst earl kitchener of khartoumpatrick victor martindale whitealpha-adrenergic blocking agentWords (1)
hexakosioihexekontahexaphobiaPhrases (11)
aleksandr nikolayevich scriabindmitri dmitrievich shostakovichtheodore roosevelt national parkstephanus johannes paulus krugerlydia kamekeha paki liliuokalanifyodor mikhailovich dostoyevskygrigori aleksandrovich potemkinalfred habdank skarbek korzybskifeodor mikhailovich dostoyevskybernd heinrich wilhelm von kleistvyacheslav mikhailovich molotovPhrases (1)
friedrich august kekule von stradonitz