Words Containing: K,A,N,T
(In Any Order)
There are 1,408 words,
1,808 phrases and
0 abbr's with
K,A,N,T in.
Best Scoring Words With: K,A,N,T
More words | |||||||
---|---|---|---|---|---|---|---|
Rank | Word | Save? | Length | Usage | Points | Type | |
1 | muntjak | 7 | 20 | nounn | |||
2 | krantz | 6 | 19 | nounn | |||
3 | twankay | 7 | 17 | nounn | |||
4 | bethank | 7 | 16 | ||||
5 | twanky | 6 | 16 | adjectiveadj | |||
6 | cutbank | 7 | 15 | nounn | |||
7 | thanked | 7 | 15 | verb, adverbv, adv | |||
8 | thangka | 7 | 15 | nounn | |||
9 | ratfink | 7 | 14 | nounn | |||
10 | tacking | 7 | 14 | verb, nounv, n | |||
or scroll down to see all results... | |||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (39)
thanks13taking11tanker10intake10anklet10keatontanked11katana10catkin12kaftan13askant10untack12kation10twanky16tanuki10kantar10bankit12takins10kainit10antick12tranks10tankas10stanks10nacket12twanks13kentia10kanted11kanten10kantha13krantz19banket12nootkakirtan10khantytake-in
...View all with 6 letters...
Phrases (3)
take ontack onwink atWords (88)
talking12blanket13skating12anklets11staking12takings12outrank11beatnik13ratfink14tankard12tacking14thankee14kantianunstack13tanbark13tankful14keratin11kyanite14untrack13unakite11antlike11intakes11kaftans14untacks13untaken11neatnik11tankers11retaken11kations11rankest11tankage12betaken13catkins13bethank16tanukis11
...View all with 7 letters...
Phrases (9)
taken uptank cartank topkola nutcake tink rationtake tendika nutgas tankWords (166)
mistaken14tracking15pakistanbankrupt16thankful18stalking13plankton14sanskritketamine14takedown16tackling15outflank15katmandubanknote14tunguskatashkentstockman16partaken14antitank12goatskin13beatniks14bunkmate16katakana16blankety17retaking13tankless12knitwear15tokonoma14ratfinks15swankest15bethanks17khanates15tweaking16stopbank16untacked15
...View all with 8 letters...
Phrases (36)
cant hooktalk intodata linkvitamin kthank youbank notebank shottank farmtank ironcrank outheat sinktank shiprack renttank suittom hanksfish tanklake tanasnake pittalk downpuka intiski pantsleft bankflat knotsneak outwest bankturn backbank ratetake downblank outtaxi ranktake notepack tentrat snakete kanawamink coat
...View all with 8 letters...
Words (203)
attacking16marketing16pakistanifrankfurt19taekwondo17undertake14mistaking16kurdistannantucketakhenatenprankster15thankless16beanstalk15swankiest16pasternakkazakstannighthawk23kathmandusnakebite15astrakhan16blanketed16newmarket18karnatakaturkestanpartaking16paintwork18texarkanasnakeroot13waterskinthinkable18crankiest15tentmaker15untracked16interbank15tackiness15
...View all with 9 letters...
Phrases (57)
tank shellthink backrain stickvitamin k1book agentant shrikebank vaultskin graftbreak intotrack downmark twainnorth peakwater tankknow apartbaking hotmax aitkentea napkintae kwon dolooking attank truckkit carsonlake tsanathink tankright banktalking tobutea kinovitamin k3grand turkstate bankbank drafttonka beanknee pantsstand backankle bootsaint luke
...View all with 9 letters...
Words (195)
bankruptcy23undertaker15thankfully23kazakhstansoundtrack17mistakenly19nutcracker18stricklandstravinskyembankment20overtaking18uzbekistancrankshaft22tajikistanmackintosh21blackthorn21breakfront19kuomintangbackbiting21blanketing17unthankful20caretaking17knockabout22handbasket20alkalinity17mountebank18knackwurst23trancelike16breakpoint18printmaker18keratinize23antinukers14outflanked18frankfurts20outranking15
...View all with 10 letters...
Phrases (78)
knut hamsunlookout manpawn ticketkey patternsneak thiefankle jointcatch a winkblock grantknock aboutpoker plantstickup mankenzo tangepacking nuttaking holdtaking overtank driverpanel trucktank enginewet blanketbarrel knoteton jacketsteak knifekalon tripaflank steakthink aboutsnake plantblacken outstark nakedoyster bankstalin peaktiger snaketinker's damnuttall oakt-bone steakparking lot
...View all with 10 letters...
Words (218)
trafficking24heartbroken20unthinkable20undertaking17rattlesnake15tutankhamunmatchmaking25painstaking18candlestick20tutankhamennightwalker22workstation18supertanker17debarkation18frankfurter21kindhearted20antismoking18leatherneck20kleptomania19meatpacking22kinesthesia18steelmaking18keratoconuskitchenware23zooplankton26maeterlinckunthinkably23embarkation19stocktaking22awestricken20granitelike16thankworthy27handbaskets21outflanking19ringstraked17
...View all with 11 letters...
Phrases (125)
gordian knotnikola teslacaptain kiddwinter breakdrain basketbanded kraittalking headblack-and-tangarden truckcentral parkanton chekovcontact mikestorage tankbank accountcoconut cakebank charterizaak waltontable napkintake a chancemake a motiontake controlback countrybroken heartwhiskey neatblack tonguecensus takertaking aparttank circuitracing skatetank farmingmagenta pinktank furnacecrank letterlake ontariocaptain cook
...View all with 11 letters...
Words (190)
thanksgiving24kindergarten18frankensteinbreathtaking22backstabbing25unmistakable20thessalonikiracketeering19kleptomaniac22cantankerous18unmistakably23stanislavskysaskatchewanmetalworking22thankfulness22turkmenistancabinetmaker22katzenjammer36unmarketable20endoskeletal17blackcurrant22earthshaking23backlighting25stakhanovite22backstopping25blacktopping25stickhandled23stickhandles22kleptomanias20watermarking22heterokaryon22frankfurters22enterokinase16outsparkling19sidetracking20
...View all with 12 letters...
Phrases (142)
plant kingdomcaptain hickstea-like drinkkitchen rangemountain bikelike an expertimmanuel kanttruck farmingkuwaiti dinarernst haeckelalaska nativemerchant banktalking pointtoasting forkground tacklegarden rocketmountain peaktree kangaroohorse blanketcontrol freakblight cankerfrank sinatraanton chekhovblack curranttavern keeperstock companystock-in-tradeancient greekmandrake rootcoast banksiaangle bracketpatrick henrytake kindly toseason ticketworking party
...View all with 12 letters...
Words (125)
heartbreaking23counterattack21skateboarding21laughingstock24painstakingly23sportsmanlike21brokenhearted23telemarketing20phytoplankton27gentlemanlike20streetwalking21anticlockwise24troublemaking22talkativeness20statesmanlike19streptokinase19kindergartner19unmistakeable21cabinetmaking24kleptomaniacs23metalworkings23backstabbings26unworkability25blacksmithing27mountebankery24phytoplankter27kindergartens19cabinetmakers23blanketflower25thanklessness20craftsmanlike24thanksgivings25stickhandlers23stickhandling24katzenjammers37
...View all with 13 letters...
Phrases (146)
yakut languagedrinking watertelephone jackalkaline metalblack-and-whitekong the masterparking ticketritual killingroller skatingthank offeringanton brucknerthree kings' daytrained workereast pakistaniantonin dvoraktajik languageaxial skeletonscotch pancakespitting snakepointlike massskin sensationpotato pancakeanxiety attacktake exceptionknight templarbanking systemautumn pumpkinblanket flowersmoking jacketrayon stockingstation keepertake one's lumpspicture takingskirting boardpancake batter
...View all with 13 letters...
Words (68)
acknowledgment27chickenhearted29unthankfulness24unthinkability26kindergartener20disembarkation23blacksmithings28phytoplankters28quarterbacking32troublemakings23laughingstocks25cabinetmakings25thankfulnesses24breathtakingly27counterattacks22backscattering25earthshakingly28strikebreaking25cantankerously23thrombokinases25skateboardings22microplanktons24keratinophilic25streetwalkings22drinkabilities21halterbreaking24phytoplanktons28telemarketings21streptokinases20alkalinization27kindergartners20nannoplanktons20balkanizations29blanketflowers26keratinization27
...View all with 14 letters...
Phrases (155)
anthony van dyckanthony vandykekitchen cabinetigor stravinskycapital of kenyastephen hawkingaround-the-clockstephen leacockchicken scratchbenjamin tuckerkwajalein atollstinking wattletalking pictureintake manifoldkeynote addressfrank r. stocktonsouth korean wonnootka languagetajiki languagepeptide linkageshark repellenttake a firm standpulmonary trunkbank withdrawalpakistani rupeevotyak languagetake for grantedworking capitalkenneth grahameblock and tackledark adaptationostyak languagestanley kubrickpocket calendarfurniture maker
...View all with 14 letters...
Words (65)
acknowledgement28unsportsmanlike23heartbreakingly28kindheartedness24kinesthetically27prekindergarten23acknowledgments28straitjacketing29ankylostomiases24ankylostomiasis24thanklessnesses22counterblockade26backscatterings26strikebreakings26disembarkations24keratinizations28unworkabilities24pharmacokinetic30unknowabilities24mountebankeries23telekinetically24phytoplanktonic31thinkablenesses24alkalinizations28kindergarteners21phenylketonuria27heartsicknesses24talkativenesses22counterattacked24counterattacker23thankworthiness28brokenheartedly28micromarketings26contraclockwise28backscratchings31
...View all with 15 letters...
Phrases (158)
kalaallit nunaatbattle of okinawacontract killingmanilkara zapotakoasati languagecapital of kansasgenus katsuwonussnake in the grassmountain hemlockalaskan malamuteattack submarinetragulus kanchilrainbow lorikeetturkish languageappointment bookturkmen languageking camp gilettebricks and mortarautomobile trunkbadminton racketbuckthorn familytamara karsavinaizanami-no-mikotodocking facilitysteering linkagekingdom of bhutantaras shevchenkowalk-up apartmentnon-profit-makingwalking delegategenus rickettsiapotemkin villagesecurity blanketcornhusker stateamerican kestrel
...View all with 15 letters...
Words (17)
heterokontophytaunthinkabilitieskinaestheticallypharmacokineticsphenylketonuriasprekindergartensacknowledgementswrinkle-resistantcantankerousnesscounterattackerscounterattackingcounterblockadedcounterblockadeskrypterophaneronknockdown-dragoutantiracketeeringknowledgeabilityPhrases (124)
dame kiri te kanawastrictly speakingcaptain james cookcock-and-bull storykwakiutl languagecapital of new yorkaram khachaturianfriendly takeoverdisease of the skinfrank lloyd wrightark of the covenantturkoman languagegenus agkistrodoncanebrake rattlercreative thinkingbook of revelationblock anaesthesiamove back and forthatakapan languageknow what's going onnegative feedbackkatharine cornellkatherine cornellhelen hunt jacksontjalling koopmanstaklamakan deserttaklimakan desertmount kilimanjaronikita khrushchevcommon pond-skaterlooking glass treeblack-necked stiltcooking chocolateblack-necked storkkitchen appliance
...View all with 16 letters...
Words (7)
leukoencephalitiskindheartednessesstraightjacketinggentlemanlikenesscounterblockadingthreskiornithidaebrokenheartednessPhrases (124)
william stricklandmount kanchenjunganikolaas tinbergenlooking-glass plantcapital of kentuckyhorned rattlesnakerobert ranke gravesblackfoot languagecapital of nebraskabeefsteak geraniumcatskill mountainscapital of pakistandunkirk evacuationsackcloth and ashesgreek monetary unitcapital of sri lankaburning at the stakejoint-stock companysubkingdom metazoavirginia snakerootbuttermilk pancakelingvo kosmopolitacommutation ticketsir anthony hopkinsmake vibrant soundscompact-disk burnercharles f. ketteringbooker t. washingtonmark the evangelistcapital of arkansasoff the beaten trackgreat grey kangaroobattle of kwajaleintaking into custodykatsuwonus pelamis
...View all with 17 letters...
Words (4)
knowledgeabilitiesgedankenexperimentcantankerousnessespocket-handkerchiefPhrases (113)
dame sybil thorndikevictor frankensteinkalmia angustifoliaintervertebral diskkamchatka peninsulaalkaline-earth metalstinking nightshadebattle of wake islandeuropean goatsuckerrudbeckia laciniatacalifornia white oakkeyboard instrumentthanksgiving cactusanton van leuwenhoekhablot knight brownemake a clean breast ofacadia national parkeastern ground snakebook of lamentationsedward lee thorndikesalt lake tabernacleanagasta kuehniellabreak someone's heartkenyan monetary unitjames mckeen cattellsir frederick ashtonendorsement in blankdenali national parkandrew dickson whiteathapaskan languagekatherine mansfieldkatmai national parkhindu kush mountainsblack-body radiationitalian honeysuckle
...View all with 18 letters...
Words (3)
gedankenexperimentsgentlemanlikenessesphosphofructokinasePhrases (94)
shakespearean sonnetmeat-packing businesshandle with kid glovescapital of kazakhstancapital of kyrgyzstaneuropean central bankcalifornia buckthornvalentina tereshkovakuwaiti monetary unitcapital of north koreaanti-takeover defenseturkmen monetary unitanton van leeuwenhoekcapital of tajikistandibranchiate molluskcapital of the ukrainenetwork architecturetrans-alaska pipelinemickey charles mantleadirondack mountainsmartin luther king daybattle of bannockburnolympic national parkkate o'flaherty chopinspoken communicationjean-baptiste lamarckkatherine anne portereskimo-aleut languageembryoma of the kidneygreat smoky mountainsdisk operating systemlepidothamnus fonkiiblack-stem spleenwortadams-stokes syndromeshirodkar's operation
...View all with 19 letters...
Words (3)
keratoconjunctivitesphosphofructokinaseskeratoconjunctivitisPhrases (71)
appendicular skeletonstephen butler leacockuniversity of nebraskarepublic of kazakhstanernst heinrich haeckelcapital of north dakotahendrik petrus berlagehugo alvar henrik aaltofrankenstein's monsteranton pavlovich chekovbread and butter pickleeastern turki languageukranian monetary unitmarket capitalisationrocky mountain bighornjohn kenneth galbraithprotective embankmentten-spined sticklebackmock turtleneck collarboykinia occidentalisnerve block anesthesiatraditional knowledgeeuropean black currantsingle-breasted jacketbluethroat pikeblennymikir-meithei languagesnake's head fritillaryketosis-prone diabetestalker identificationrank-order correlationeuropean house crickethexalectris warnockiihendrik antoon lorentzrepublic of tajikistanwind cave national park
...View all with 20 letters...
Words (1)
alkylbenzenesulfonatePhrases (79)
aleksandr solzhenitsynbillie jean moffitt kingstephen william hawkingsri lankan monetary unitketorolac tromethamineagkistrodon contortrixaram ilich khachaturianisle royal national parkanton pavlovich chekhovantonie van leeuwenhoekcapital of turkmenistanbank-depositor relationpakistani monetary unitknight of the round tablejack roosevelt robinsonjohn fitzgerald kennedythomas jonathan jacksonthomas kennerly wolfe jr.battle of lake trasimenewilliam schwenk gilbertspeaker identificationkurdistan workers partykurdistan workers' partyatrioventricular blockamerican stock exchangenerve block anaesthesiaatrioventricular trunkthin-leaved stringybarkketamine hydrochloridewinter crookneck squashskeleton in the cupboardcalifornia black walnutcommon stock equivalentgospel according to lukegreater prairie chicken
...View all with 21 letters...
Words (2)
keratoconjunctivitideskeratoconjunctivitisesPhrases (51)
aleksandr i. solzhenitsynjohn ronald reuel tolkienfrancis richard stocktonedward kennedy ellingtonjan evangelista purkinjeblack-crowned night heroncharlotte perkins gilmanpearl sydenstricker buckblack-fronted bush shrikeeverglades national parkhot springs national parksubdivision ginkgophytablack-stemmed spleenwortmetrazol shock treatmentarchidiskidon imperatordiamondback rattlesnakeplantation walking horseernestine schumann-heinkbyzantine greek languagecrater lake national parkisle royale national parkkonstantin stanislavskyshenandoah national parkgrand teton national parkfrank winfield woolwortherskine preston caldwellarcuate vein of the kidneymourning cloak butterflyelectroweak interactionnew york state barge canalthree-spined sticklebacksaddle block anaesthesiakendall rank correlationwestern black-legged tickmatthias jakob schleiden
...View all with 22 letters...
Phrases (55)
family threskiornithidaetransient ischemic attackyellowstone national parkkazakhstani monetary unitlewis and clark expeditionkyrgyzstani monetary unitcanyonlands national parksouth korean monetary unittyrosine kinase inhibitortajikistani monetary unituzbekistani monetary unitwilliam cuthbert faulknerkingdom of the netherlandssir anthony philip hopkinsletter of mark and reprisaldame kiri janette te kanawaragnar anton kittil frischsir john douglas cockcroftauto-blocking belay devicecount maurice maeterlinckbryce canyon national parkmammoth cave national parkkobuk valley national parkbattle of the caudine forksbenjamin ricketson tuckerfriedrich august von hayekislamic party of turkestantheory of weak interactiongrand canyon national parkwernicke's encephalopathybraxton-hicks contractionfranklin delano rooseveltvirginia katherine mcmathdual inline package switchmagnetostrictive speaker
...View all with 23 letters...
Phrases (29)
division heterokontophytarichard buckminster fullermax karl ernst ludwig planckhashemite kingdom of jordansubdivision ginkgophytinamount rainier national parkfrancis henry compton crickcounterclockwise rotationislamic group of uzbekistanketosis-resistant diabetespartiya karkeran kurdistanbattledore and shuttlecocknickel-cadmium accumulatoranatoli yevgenevich karpovwireless local area networkarcuate artery of the kidneybank identification numbersoutheastern pocket gopherlucy in the sky with diamondshuman t-cell leukemia virus-1ayatollah ruholla khomeinidavid lewelyn wark griffithcortinarius atkinsonianuscharles franklin ketteringsir frederick grant banting4.5-inch beach barrage rocketnaked as the day you were bornkatharine houghton hepburnkund johan victor rasmussenPhrases (31)
igor fyodorovich stravinskyfrancis scott key fitzgeraldboris leonidovich pasternakrudolf christian karl dieselsaddam bin hussein at-takrititrans-alaska pipeline systempyotr alexeyevich kropotkinandrei arsenevich tarkovskycosmic background radiationpodkamennaya tunguska riverangus frank johnstone wilsonketoacidosis-prone diabetesmikhail yurievich lermontovislamic republic of pakistanrank-difference correlationvirgin islands national parkjoint direct attack munitionchamaecyparis nootkatensiscapital of the united kingdomchronic myelocytic leukemiafederal home loan bank systemhenry kenneth alfred russellcommunist party of kampucheabruckenthalia spiculifoliaperiwinkle plant derivativerashtriya swayamsevak sanghnorth cascades national parkbranched chain ketoaciduriakeratoderma blennorrhagicarocky mountain national parkrocky mountain spotted feverPhrases (25)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkx-linked dominant inheritancelassen volcanic national parkdorothy mary crowfoot hodgkinkarl rudolf gerd von rundstedtemployee stock ownership planbooker taliaferro washingtonandrei dimitrievich sakharovmikhail ilarionovich kutuzovcockcroft-walton acceleratorchristoph willibald von gluckfirst baron marks of broughtonchronic lymphocytic leukemiaeastern red-backed salamanderunited mine workers of americawestern red-backed salamanderbaron richard von krafft-ebingneuromuscular blocking agentblack september organizationbaroness jackson of lodsworthbaroness thatcher of kestevenkathleen mansfield beauchamppresident franklin rooseveltPhrases (26)
nikita sergeyevich khrushchevdirector-stockholder relationbeta-adrenergic blocking agentjerusalem artichoke sunflowertaras grigoryevich shevchenkofalkland islands monetary unitx-linked recessive inheritanceuniversity of nebraska-lincolngeorgi konstantinovich zhukovrudbeckia laciniata hortensiawrangell-st. elias national parkpetrified forest national parkjohannes evangelista purkinjeradioactive iodine uptake testhawai'i volcanoes national parkhawaii volcanoes national parkindustrial workers of the worldkennedy international airportmujahidin-e khalq organizationeysenck personality inventorymartin luther king jr's birthdaywilliam iv of the united kingdombaron karl wilhelm von humboldtkepler's law of planetary motioncarlsbad caverns national parksclerosing leukoencephalitisPhrases (13)
strategic arms limitation talksmicrosoft disk operating systemsergei mikhailovich eisensteincount lev nikolayevitch tolstoygates of the arctic national parkkonstantin sergeevich alekseevkaposi's varicelliform eruptioneast turkestan islamic movementeast turkistan islamic movementfirst earl kitchener of khartoumpatrick victor martindale whitealpha-adrenergic blocking agentrocky mountain bristlecone pineWords (1)
hexakosioihexekontahexaphobiaPhrases (10)
katmai national park and preservetheodore roosevelt national parkstephanus johannes paulus krugerketoacidosis-resistant diabetescockcroft and walton acceleratorgrigori aleksandrovich potemkinkendall partial rank correlationteodor josef konrad korzeniowskiwestern diamondback rattlesnakedenali national park and preservePhrases (11)
patent and trademark office databaseweakly interacting massive particlesergei aleksandrovich koussevitzkycount nikolaus ludwig von zinzendorfuniversity of california at berkeleyketosis-resistant diabetes mellituscockcroft-walton voltage multiplieryevgeni aleksandrovich yevtushenkowilhelm apollinaris de kostrowitzkijohn f. kennedy international airportlake clark national park and preserve