Words Containing: E_
(In Exact Order)
There are 187,404 words,
49,598 phrases and
230 abbr's with
E_ in.
Best Scoring Words With: E_
More words | |||||||
---|---|---|---|---|---|---|---|
Rank | Word | Save? | Length | Usage | Points | Type | |
1 | bezzazz | 7 | 45 | verb, nounv, n | |||
2 | pzazzes | 7 | 36 | nounn | |||
3 | quizzed | 7 | 35 | verb, adjectivev, adj | |||
4 | bezazz | 6 | 35 | noun, adjectiven, adj | |||
5 | zizzled | 7 | 35 | verbv | |||
6 | quizzes | 7 | 34 | nounn | |||
7 | zizzles | 7 | 34 | verbv | |||
8 | quizzer | 7 | 34 | nounn | |||
9 | jazzmen | 7 | 34 | nounn | |||
10 | zizzed | 6 | 34 | verbv | |||
or scroll down to see all results... | |||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (241)
get4her6see3let3yes6hey9new6eat3yet6men5end4few9set3met5bed6red4ten3bet5eye6sea3tea3key10ben5leg4lee3beg6yep8wet6per5ear3led4eve6egg5pen5fed7
...View all with 3 letters...
Abbreviations (78)
leomeiceoneohelzendesweiedojemdealempeiespdeceseiedfebepaekgsebelaepieeglerectecgsepneymevnecdedqedertecm
...View all with 3 letters...
Words (1254)
here7they10yeah10well7when10them9then7were7tell4been6need5very10over7mean6even7help9does5keep10feel7ever7left7hear7next11dead6else4went7real4best6seen4head8meet6used5year7open6idea5
...View all with 4 letters...
Phrases (8)
a fewbe ongen xone cet alet al.leo ileo xAbbreviations (131)
leonsethchenlenaowenherrabelzeusokeygaelperurenosenortheapennneeldevineroherafemameirleviwebbreidkievserbezraivesellibernvedableulegoveauelia
...View all with 4 letters...
Words (4692)
there8where11never8these8their8great6after8money10other8leave8years8hello8every11three8being8ready9heard9haven11later5heart8guess6water8sleep7times7check16death9speak11comes9under6means7women10least5break11honey11jesus12
...View all with 5 letters...
Phrases (56)
use upget itget toc clefg clefpep upend onfed upi. m. peilet gov-e daylet onlet upe. colibe dueset inf clefeat upno endb cellget atget inget ontype atv settype btype oget upweb tvbet onegg ont cellpen upid estsex up
...View all with 5 letters...
Abbreviations (12)
Dec-24Dec-25Sep-11Feb-02Feb-12Feb-14Feb-22Feb-29Dec-31Dec-08Sep-17Sep-29Words (12127)
really9people10please8before11better8father12mother11listen6wanted10enough10friend10called9excuse15matter8myself14pretty11forget10second9person8happen13sister6number10moment10become12behind12scared9answer9reason6either9dinner7coffee14return6street6master8longer7
...View all with 6 letters...
Phrases (277)
sea godused toever soorb webfess uptin earmt etnatag endpipe inred bayfire upfelt uprise uprope inde luxecow penrope upbone uphew outpro tembeef upegg cupline uplead onred elmcage inpen nibbent onlive inkeep inlive onurge ontrue totab keyquite a
...View all with 6 letters...
Abbreviations (2)
omega-3omega-6Words (20208)
because11believe12someone9another10already11brother12getting9problem13minutes9exactly19married10welcome14between12serious7leaving11telling8feeling11special11perfect14careful12himself15perhaps14evening11meeting10changed14clothes12explain16wedding13decided12forever13worried11teacher12officer15americamessage10
...View all with 7 letters...
Phrases (778)
no-see-umname tagmelt offby heartdie downtea gownw. h. audensea gullspear upair cellsea holmspew outheat rayget oversea lilyoffer upbee balmcarve upin briefsea mossbee mothbest manpet shopseed lachead offgeorge vsun beltbear cublie downget wiseclose torange inget wordtie downsun deck
...View all with 7 letters...
Words (26031)
remember14yourself14together12everyone14business10whatever17children14daughter13somebody16supposed13question17finished15americanaccident13speaking15anywhere17security13terrible10sleeping11pleasure10evidence14suddenly13personal10promised13pregnant11involved15director11decision11computer14princess12complete14feelings12interest8nonsense8innocent10
...View all with 8 letters...
Phrases (1638)
white antcover forsea floorw. c. fieldsmelt downleave outel muertofilm fernfield hutfree fallheat pumppaul kleefree formgeorge ivel qahirastone pitsea horsemax ernstair coverbean curdfire ironline feedminor keysieve outbean townedge toolheated upmess hallfire saleget stucknext doorsea lousecarve outhead licesheet web
...View all with 8 letters...
Words (28483)
something15beautiful14different16everybody21sometimes13somewhere17yesterday16wonderful16happening17president12boyfriend18dangerous11attention9seriously12afternoon12certainly14beginning13listening10apartment13otherwise15professor14ourselves12screaming14detective15necessary14excellent18breakfast18wondering14surprised12forgotten13operation11expensive21recognize21character16happiness16
...View all with 9 letters...
Phrases (2732)
small beerfelis oncalittle aukcoffee mugcone shapegenus glisslide boltcover songbitter endlobed leafboot makerface valuebean aphidpearl sagorate of payfilm makergenus craxslide downgreat sealdirect dye.45-caliberlake nyasagreat skuatank shellgenus crexline drivepast tenseebro rivertv channelwhite beerworm wheelpast timesstone wallbleach outchurch key
...View all with 9 letters...
Words (26986)
everything20understand12girlfriend15absolutely15completely19government16interested11definitely17especially17everywhere22difference19experience21themselves18understood12appreciate16sweetheart16restaurant10department15incredible15lieutenant10university16apparently17discovered17television13permission14personally15eventually16connection14friendship19protection14successful17considered14technology19revolution13afterwards17
...View all with 10 letters...
Phrases (3824)
swage blockoff-the-rackfossil fuelshort sleephindu deityabel tasmanyves tanguyrhone rivertea essencepole weaponstone fruitoff-the-wallgenus inulagenus lyguswoody allenmary leakeycover platedisk accessfleur-de-lyshard workerhigh reliefupupa epopsnavel pointpast masterepoxy resinskagen oddechurch bellcoffee ringdirect costdwarf elderair cleanerline backerblood serumdeposit boxedgar degas
...View all with 10 letters...
Words (22272)
interesting12immediately19responsible15grandfather19grandmother18complicated20appointment17competition17performance20coincidence18concentrate15electricity18embarrassed16environment16intelligent12explanation20temperature15underground14destruction14anniversary17threatening15personality16considering15experienced23development19authorities14transferred15differently21forgiveness18independent15necessarily16technically21investigate15celebrating16magnificent19
...View all with 11 letters...
Phrases (4316)
isaac singermount elbertname dropperpearl harborpole vaultergenus lycosagenus myxinegreat revoltsummer sweetbeam of lightbitter aloeslook out overcatha edulisoff-the-shelfgenus crambe's gravenhageleave officebooster shotplant hoppertribal chiefflower chaintribal sheikbody of waterbooster unitprairie wolffilm editingflower childshort temperslide actionbitter cresslouis leakeybreathing inrubbish heapsilver berryskagens odde
...View all with 11 letters...
Words (16680)
relationship17conversation17professional17unbelievable19neighborhood22intelligence15embarrassing17disappointed18photographer23headquarters25consequences25surveillance17commissioner18announcement16specifically24presentation14independence18nevertheless18accomplished24accidentally20registration13instrumental14intellectual14prescription18confidential18refrigerator16kindergarten18philadelphiapresidential15entertaining13architecture19compensation18difficulties21deliberately18unacceptable20
...View all with 12 letters...
Phrases (4543)
louis jollietbronco busterrun-of-the-millgraham greenespace capsulehard-to-pleasetrouble makerathene noctuapole vaultingelihu thomsonalec guinnessmeasuring rodmortise jointmount everestold ironsidesel libertadorpitt the elderfilm directorgenus porzanaabelian grouptribal sheikhrate of growthsecond adventgenus anethumhelen traubellouis pasteurbusiness firmcommon persongenus sturnusgrain cleanerserious musicarnold gesellknuckle jointlake michiganmary magdalen
...View all with 12 letters...
Words (11511)
unfortunately19investigation17international13understanding16circumstances21extraordinary24entertainment15investigating18consciousness17revolutionary19demonstration16concentration17granddaughter20approximately29neighbourhood23sophisticated21interrogation14irresponsible17establishment20misunderstood17grandchildren21consideration16underestimate16environmental18disappearance20misunderstand17embarrassment19determination16unpredictable20distinguished19inconvenience20superstitious15controversial18reincarnation15mediterranean16
...View all with 13 letters...
Phrases (4692)
telegraph postjohn masefieldbakke decisionpartial breachdwarf chestnutfelis concolorgenus blaberusharvey cushingaleatory musicoutside clinchpaul hindemithel iskandriyahremovable diskvaginal arterywhite asbestoscartridge clipchannel islanddelphic oracledirect antonymgenus struthiotrade stoppagebitter cassavamight-have-beenauditory senseblood relationpar excellenceblood relativemeasuring unitchelone glabrafelis pardalisgrass parakeetlarix sibericawhite backlashmeasuring wormneglect of duty
...View all with 13 letters...
Words (7778)
responsibility21representative19identification20disappointment21recommendation21superintendent17interpretation16pharmaceutical25understandable18simultaneously19representation16rehabilitation19professionally22correspondence21reconstruction18scientifically24reconciliation18characteristic23reconnaissance18unprofessional19czechoslovakiahypothetically30accomplishment27cinematography27slaughterhouse21archaeological22systematically24indestructible19understatement17unconventional19intellectually19fundamentalist20coincidentally22unintelligible17metaphorically26
...View all with 14 letters...
Phrases (4619)
leave of absencefamily apiaceaefertilized ovumgalileo galileiimperative formalpine clubmossbasque languagenegeri sembilanpassover suppergenus pelecanusimperative moodtrouble oneselfoff-the-shoulderpearl mae baileyexpense accountamphibole grouptrouble shooterprotein foldingimperative verblobe-finned fishconiferous treedirect contrastseriola grandisanthony burgessweather outlookmarc blitzsteinneutral spiritspier luigi nervigarageman's liengelatin dessertkissing diseasecircuit breakerprivate citizengenus blattellajacques cartier
...View all with 14 letters...
Words (5031)
electromagnetic22confidentiality24extraordinarily26revolutionaries18internationally18cinematographer25professionalism22experimentation26extracurricular26psychotherapist30unconsciousness19methamphetamine29technologically26unintentionally18acknowledgement28instantaneously18environmentally23pithecanthropus27underprivileged23decontamination20personification22entrepreneurial17inappropriately24monounsaturated18intussusception19unsophisticated23disenfranchised25inconsequential26anaesthesiology22unsubstantiated18disrespectfully26disillusionment18interchangeable23flibbertigibbet27overzealousness27
...View all with 15 letters...
Phrases (4225)
measuring devicepanel discussionfelis domesticusrobert e. sherwoodstay of executionteutoburger waldiridaceous plantavestan languagecentaurea cyanuscharlotte brontedame muriel sparkfalco peregrinusseriola dorsalisitalian dressingjunction barrierbenefit of clergybitter chocolatecharlotte cordayoutside marriagepresident hooverasperula odoratabusiness expensestrait of georgiahigh renaissanceclass pelecypodanewton's first lawalimentary pastehelen wills moodycapital of greeceperfective tenseebony spleenwortgenus potentillaalectoris graecajacques cousteausingapore dollar
...View all with 15 letters...
Words (1854)
misunderstandingextraterrestrialincomprehensibleenthusiasticallyintercontinentalenvironmentalistindiscriminatelyanesthesiologistelectromagnetismirresponsibilitycounterterroristpheochromocytomaneurotransmittergastrointestinalundersecretariestranscontinentalincontrovertibleunderdevelopmentcounterclockwisehemorrhoidectomycharacterizationincomprehensiblyaustralopithecusenvironmentalismmultidimensionalcounteroffensiveprestidigitationcounterterrorismpseudoscientificshortsightednesscountersignaturetriphenylmethanerepresentationalhyperintelligentunpredictability
...View all with 16 letters...
Phrases (3621)
hypodermic needletympanic membranemultiengine planecommedia dell'arteczar alexander iiigenus utriculariaarteria vaginalisbattle of marathonmanihot esculentadame kiri te kanawain a beastly manneratopic dermatitiscartridge ejectorprofessional lifegenus crassostreagenus elaeocarpusitalian greyhoundedgar albert gueststrictly speakingbattle of monmouthcapital of georgianeritid gastropodperfective aspectdelphinium ajacisgenus angiopterisprivate detectivestrait of magellanw. somerset maughamcartridge removerpresident johnsonproteles cristatafamily cyperaceaechelonian reptilechristian huygensbattle of omdurman
...View all with 16 letters...
Words (1054)
institutionalizedcounterproductiveimmunosuppressiondepersonalizationtelecommunicationimmunosuppressiveconversationalistcommercializationcounterinsurgencymisinterpretationintergovernmentalmisidentificationunconventionalitybacteriologicallyimmunosuppressanttranscendentalisminstitutionalisedmisrepresentationcounterrevolutionconscientiousnesssuperconductivityelectrocardiogramdeconstructionistelectroconvulsivecompartmentalizedparathyroidectomyperchloroethylenereconstructionismmaterialisticallyreconstructionistchemiluminescenceintellectualizingcardiorespiratorytriskaidekaphobianeurophysiologist
...View all with 17 letters...
Phrases (3219)
horizontal sectioncapital of ethiopiaobject recognitiongopherus agassiziiheat of sublimationjacqueline cochranweather forecasterdame margot fonteyngopherus polypemuslarix occidentalismary leontyne pricemount godwin austencompetence hearingdirect correlationaquilegia vulgarispontederia cordatagenus globicephalamount kanchenjungarobert falcon scottlandscape gardenersalvia leucophyllagenus ceratosaurusbalaena mysticetuscivil rights leaderclomiphene citratejohn moses browninglandscape paintingczech monetary unitacherontia atroposprivate instructorproteolytic enzymemespilus germanicarepublic of armenialebanese hizballahmary mcleod bethune
...View all with 17 letters...
Words (566)
telecommunicationscharacteristicallydisproportionatelycompartmentalizinginternationalizinginconsequentialityhypercoagulabilitygastroenterologistinterconnectednessoversimplificationspectrophotometricantivivisectionisthyperaldosteronismdisenfranchisementoverrepresentationinterchangeabilityneuropsychologicalpaleoclimatologistinexpugnablenessesthermoluminescenceunintelligiblenesshypersensitivenesspolyesterificationspectrofluorometrymethyltestosteroneexterritorialitieshypersensitivitieshypersensitizationpolymorphonuclearscommensurabilitiesmisidentificationsspectroheliographselectrodynamometercommercializationscounterstrategists
...View all with 18 letters...
Phrases (2657)
hindu calendar monthabel janszoon tasmanbombycilla cedrorunworldly possessionsbusiness enterprisearteria vertebraliswashington monumentoceanites oceanicusdouble-deck carriageprofessional golfererinaceus europaeusrevolutionary groupgenus struthiomimusheat of vaporisationadministrative bodyamerican revolutiontuamotu archipelagodrafting instrumentheat of vaporizationisabella i of castilephotographer's modelpresident jeffersonfamily physeteridaeanamnestic reactiondame sybil thorndikeprivate corporationeriobotrya japonicaandromeda polifoliabackspace characterlachrymal secretioncapital of guatemalafreudian psychologygenus styracosaurusadministrative unitperomyscus leucopus
...View all with 18 letters...
Words (342)
counterintelligencehyperparathyroidismcountertransferencesternocleidomastoidpseudohermaphroditeelectroluminescenceintellectualizationpneumoencephalogramcinematographicallystraightforwardnessspectrofluorometricunintelligibilitiesthermoluminescencespolyesterificationsdisenfranchisementsthermoperiodicitieshypersensitizationsextralinguisticallycountersurveillanceextraordinarinessespolyribonucleotidesprofessionalisationknowledgeablenessesextraterritorialityhypersusceptibilityunpretentiousnessesprofessionalizationantivivisectionistsspectrophotometriesparathyroidectomiesultracentrifugationnonproductivenessessurface-assimilativecommunicativenesseshypolipoproteinemia
...View all with 19 letters...
Phrases (2069)
water-plantain familymeasuring instrumentacetylsalicylic acidrecursive definitionfavourable receptionbattle of marston moorerinaceus europeaeusallium cepa viviparumaquilegia canadensisfamily cyclopteridaerobert emmet sherwoodsierra madre orientalrejoicing over the lawseventeen-year locustitalian monetary unitsuperior conjunctionhydrastis canadensisallium schoenoprasumlatvian monetary unitlepidopterous insectmillimeter of mercurytheodore harold whitecollective agreementturbo-propeller planealpine type of glaciercease and desist orderread between the linesgiles lytton stracheymicromeria douglasiiphytolacca americanafamily lepisosteidaezairese monetary unitshakespearean sonnetbarren ground cariboupellaea rotundifolia
...View all with 19 letters...
Words (158)
counterrevolutionaryuncharacteristicallycompartmentalizationhypercholesterolemiaoverenthusiasticallyinternationalizationtetrahydrocannabinolelectroencephalogramparadichlorobenzenesspectrofluorometriessemiautobiographicalunintelligiblenesseshypersensitivenessesspectroheliographiespolyphiloprogenitivekeratoconjunctivitesradiopharmaceuticalscountersurveillancesspectrophotometricalparathyroidectomizedcountertransferencesabetalipoproteinemiaunrepresentativenesscounter-revolutionistunsatisfactorinessesreconceptualizationshyperadrenocorticismcomprehensiblenessescounterdemonstrationcytodifferentiationslymphogranulomatosesimmunocytochemicallydistinguishabilitiesforethoughtfulnessesintellectualizations
...View all with 20 letters...
Phrases (1585)
william stanley jevonssuborder strepsirhinisweet-scented geraniumarcheological remainsallium cepa aggregatumpelecanus onocrotalusblack-capped chickadeecalendula officinalisgilbert charles stuarthonduran monetary unityellow-shafted flickerappendicular skeletonwyethia amplexicaulisorder mycelia steriliapara aminobenzoic acidprofessional relationabelmoschus moschatusdwarf flowering almondfamily phytolaccaceaephotographic emulsionmalawian monetary unitpast progressive tenseinstruction executionlebanese monetary unitwilliam wilkie collinsorder myxobacterialesevergreen bittersweetbusiness organisationmultilinear evolutionlunar excursion modulebusiness organizationsir karl raimund popperbalaenoptera physalusfamily trachipteridaesecond coming of christ
...View all with 20 letters...
Words (56)
electroencephalographhypogammaglobulinemiadisestablishmentarianextraterritorialitieshypersusceptibilitiescompartmentalizationsstereomicroscopicallymultidimensionalitiesimmunocytochemistriesconstructive-metabolicstraightforwardnessesimmunoelectrophoresesimmunoelectrophoreticestablishmentarianismalkylbenzenesulfonateinterchangeablenesseselectrocardiographiesacetylcholinesterasespseudohermaphroditismneuroendocrinologicalneuroendocrinologistsinterconvertibilitieselectroencephalogramscontemporaneousnessesadrenocorticosteroidsadrenocorticotrophinsphosphoglyceraldehydeotorhinolaryngologiesmeningoencephalitideselectromyographicallybuckminsterfullerenesdendrochronologicallyovercommercializationinternationalizationsimmunoelectrophoresis
...View all with 21 letters...
Phrases (1191)
use of goods and servicesacrocentric chromosomesir john everett millaisagglutinative languagesierra madre occidentalabelmoschus esculentusadministrative hearingelimination tournamenthead and shoulders abovesierra nevada mountainsdirect electric currentfrances hodgson burnettexperimental conditioncercopithecus aethiopsgasterosteus pungitiushelianthemum scopariumicelandic monetary unitanaphalis margaritaceadiametrical oppositionelaeagnus augustifoliaelectrolytic condenseraleksandr solzhenitsynmalaysian monetary unitanthriscus cereifoliumexecution of instrumentbureaucratic procedurerepublic of cote d'ivoirebattle of soissons-reimshelichrysum bracteatumalan bartlett shepard jr.musculus intercostalisbulgarian monetary unitconfederate rose mallowspontaneous generationtelephone conversation
...View all with 21 letters...
Words (29)
counterrevolutionarieskeratoconjunctivitidespentamethylenetetrazolkeratoconjunctivitisesdisestablishmentariansspectrophotometricallyunrepresentativenessesnonrepresentationalismimmunohistochemistriesreinstitutionalizationphiloprogenitivenessesintercomprehensibilitydeinstitutionalizationelectroencephalographselectroencephalographyphosphoglyceraldehydescarboxymethylcelluloseovercommercializationselectrophysiologicallyhexamethylenetetramineincomprehensiblenessesencephalomyocarditisescountercountermeasuresdihydroxyphenylalanineestablishmentarianismsindistinguishabilitiesmicrospectrophotometercounterinterpretationsmicrospectrophotometryPhrases (901)
venezuelan monetary unitdisjunctive conjunctionlycopersicon esculentumadministrative districtadministrative divisiongilbert keith chestertongregorian calendar monthprunus persica nectarinahaliaeetus leucorhyphusadministrative officialtransient global amnesiaschlumbergera truncatuscoronavirus disease 2019posterior nasal apertureredevelopment authorityhydrated aluminium oxidenavigational instrumenttrazodone hydrochloridebarbara wertheim tuchmanleishmaniasis americanaaleksandr i. solzhenitsynsir laurence kerr olivierherbert marshall mcluhanitalian vegetable marrowaccessory before the factviola tricolor hortensisinstrument of punishmentequal-area map projectionfamily dendrocolaptidaejohn ronald reuel tolkienmultiple mononeuropathyfoeniculum vulgare dulceteacher-student relationuniform resource locatorloyalist volunteer force
...View all with 22 letters...
Words (15)
electroencephalographicnonrepresentationalismsreinstitutionalizationselectroencephalographerdeinstitutionalizationscarboxymethylcellulosespolytetrafluoroethylenehexamethylenetetraminesintersubstitutabilitiesoverintellectualizationdichlorodifluoromethaneindistinguishablenesseshypobetalipoproteinemiamicrospectrophotometersmicrospectrophotometricPhrases (607)
gilbert and ellice islandsfamily threskiornithidaeparenthetical expressiontransient ischemic attacksecond battle of el alameingeorge macaulay trevelyanposterior pituitary glandchlorpheniramine maleateto all intents and purposesarchibald percival wavellmeperidine hydrochloridenikolai vasilievich gogolsubpoena ad testificandumboeing b-52 stratofortressyellowstone national parkelectromechanical devicetweedledum and tweedledeeaugust wilhelm von hofmannkazakhstani monetary unitcalycanthus occidentalisparis-sorbonne universityinterlocutory injunctionpharmacological medicinegenus pseudopleuronecteshippoglossus stenolepsisapium graveolens rapaceumstercorarius parasiticusbrassica oleracea italicaaristolochia serpentariathiopentobarbital sodiumclassified advertisementlewis and clark expeditionanastatica hierochunticacapital of papua new guineasarvepalli radhakrishnan
...View all with 23 letters...
Words (13)
microgramma-piloselloideslaryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyintercomprehensibilitiesphosphatidylethanolamineelectroencephalographerselectroencephalographiesmicroelectrophoreticallyoverintellectualizationsdichlorodifluoromethanesmicrospectrophotometriesschizosaccharomycetaceaePhrases (490)
basque homeland and freedomcarnegie mellon universityprofessional organisationprofessional organizationlouis seymour bazett leakeylowland burrowing treefrogpelham grenville wodehouseargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytasubphylum cephalochordatamary wollstonecraft godwinunidentified flying objectprivately held corporationtrip the light fantastic toecapture of fort ticonderogazollinger-ellison syndromeprimary sex characteristicbattle of the little bighornsir terence mervyn rattiganbattle of the philippine seabattle of the spanish armadabrassica oleracea acephalabrassica oleracea botrytisbrassica oleracea capitatadistinguished flying crossfrancois auguste rene rodinadolf otto reinhold windauscapital of northern irelanddmitri ivanovich mendeleevarthur meier schlesinger jr.hunting and gathering tribecucumis melo cantalupensisgottfried wilhelm leibnitzcommonwealth of the bahamas
...View all with 24 letters...
Words (3)
immunoelectrophoreticallyphosphatidylethanolaminesantiestablishmentarianismPhrases (356)
count ferdinand von zeppelinunited states secret serviceembryonal rhabdomyosarcomacluster of differentiation 4myroxylon balsamum pereiraecosmic microwave backgroundbalaenoptera acutorostratabureau of justice assistancebureau of justice statisticsmary wollstonecraft shelleymiguel de cervantes saavedradiamond wedding anniversarymusculus quadriceps femorisfrancis scott key fitzgeraldbattle of the chemin-des-dameschemical weapons conventioncruel and unusual punishmentbrassica oleracea gemmiferanational science foundationdistinguished service medalfriedrich wilhelm nietzschetherapeutic rehabilitationcentral intelligence agencyfast local internet protocolboris leonidovich pasternakmodest petrovich mussorgskyedmund john millington syngerudolf christian karl dieselpropoxyphene hydrochloridewar of the spanish successiondistribution free statisticproprietorship certificatesecret intelligence serviceantonio allegri da correggiosternocleidomastoid muscle
...View all with 25 letters...
Phrases (252)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkbattle of monmouth court housefrances eliza hodgson burnettshort-spurred fragrant orchidx-linked dominant inheritanceconfederate states of americabacon-lettuce-tomato sandwichsir sarvepalli radhakrishnannational institutes of healthright atrioventricular valvebattle of the teutoburg forestbrassica oleracea gongylodespolicing and enforcement costalternanthera philoxeroidescorrectional rehabilitationhunting and gathering societylassen volcanic national parkwar of the austrian successionanton grigorevich rubinsteinmalignant neoplastic diseaseadrenocorticotropic hormonepersonal information managerjames abbott mcneill whistlerhuman immunodeficiency virussecretary of veterans affairsjohn burdon sanderson haldaneherpes varicella zoster viruskarl rudolf gerd von rundstedtdepartment of transportationemployee stock ownership planunited arab emirates's capitalsir charles scott sherringtonstanding operating procedure
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (178)
business environment analysispartial differential equationamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinorder of our lady of mount carmelelectromechanical transduceroffice of management and budgetsolenostemon scutellarioidesnational labor relations boardaugustus welby northmore pugindirector-stockholder relationfreedom from search and seizureco-operative republic of guyanabeta-adrenergic blocking agentcommissioned military officerelectronic musical instrumentnuclear regulatory commissionjerusalem artichoke sunflowerpull the wool over someone's eyestriticum dicoccum dicoccoidesadrenocorticotrophic hormonedeoxyadenosine monophosphatesecretary of commerce and laborsocial development commissiontricyclic antidepressant drugdeoxythymidine monophosphateinternational court of justicejames augustine aloysius joycepositive reinforcing stimulusthyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenko
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (153)
revolutionary people's strugglecoccothraustes coccothraustesinterstate commerce commissionaleksandr feodorovich kerenskybusiness process reengineeringbureau of engraving and printingephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngerstrategic arms limitation talksfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskydistinguishing characteristiccardiopulmonary resuscitationmicrosoft disk operating systemcommission on the status of womenbattles of lexington and concordcapital of serbia and montenegrojohan julius christian sibeliusdemocratic republic of the congocriminal investigation commandfederal housing administrationfeodor mikhailovich dostoevskifeodor mikhailovich dostoevskyludwig josef johan wittgensteindepartment of homeland securitygrace ethel cecile rosalie allenmaster of arts in library sciencesuperconducting supercollidersergei mikhailovich eisensteincongregation of the inquisitiondissident irish republican armyfrederick william iii of prussiarevolutionary communist league
...View all with 28 letters...
Words (2)
methylenedioxymethamphetaminehexakosioihexekontahexaphobiaPhrases (115)
business environmental analysisbusiness interruption insurancesecond council of constantinoplealeksandr nikolayevich scriabinchemical decomposition reactionacrylonitrile-butadiene-styreneantisocial personality disordermale internal reproductive organfriedrich wilhelm august froebelnational volunteers associationdisorganized type schizophreniadmitri dmitrievich shostakovichautomatic data processing systemcombination in restraint of tradecapital of the dominican republicsouth-central dravidian languagegiovanni pierluigi da palestrinacapital of the russian federationsao thome e principe monetary unitscrutin uninominal voting systemedward george earle bulwer-lyttoninternational olympic committeemiddle east respiratory syndromeferdinand joseph la menthe mortonunited arab emirate monetary unitbaron de la brede et de montesquieucongregational christian churchdisseminated multiple sclerosisreceived pronunciation languagekatmai national park and preservehydrangea macrophylla hortensisconstitution of the united statestheodore roosevelt national parkstephanus johannes paulus krugerautoclaved lightweight concrete
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (86)
battle of spotsylvania court housebattle of spotsylvania courthousevalentina vladmirovna tereshkovamusculus sternocleidomastoideusreduced instruction set computingalexander isayevich solzhenitsynglutamic oxalacetic transaminaseobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencedouble standard of sexual behaviorcoluber constrictor flaviventrisjacques anatole francois thibaultdepository financial institutionvicomte ferdinand marie de lessepsethylenediaminetetraacetic acidrepublic of bosnia and herzegovinaaleksandr mikjailovich prokhorovuniversal gravitational constantbalance of international paymentsmultiple correlation coefficientaugust friedrich leopold weismannwaterhouse-friderichsen syndromesevere acute respiratory syndromesevere combined immunodeficiencyalessandro di mariano dei filipepipolymonium caeruleum van-bruntiaehyperbilirubinemia of the newborncalymmatobacterium granulomatismusculus transversalis abdominiscalifornia personality inventoryfield-sequential color televisioncomplex instruction set computingplasma thromboplastin antecedent
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (80)
united states public health servicegreat smoky mountains national parkbureau of intelligence and researchsecond epistle to the thessaloniansfreedom from involuntary servitudemarie louise elisabeth vigee-lebrundigital communications technology2019-ncov acute respiratory diseasepetroselinum crispum neapolitanumguiseppe fortunino francesco verdiunited states department of defensetupac amaru revolutionary movementsidonie-gabrielle claudine colettesir john frederick william herschelunited states trade representativefrances elizabeth caroline willardrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezchickasaw national recreation areaposterior vein of the left ventriclepalestine liberation organizationmanipulative electronic deceptioninterstitial plasma cell pneumoniapalestinian popular struggle frontanicius manlius severinus boethiuselectromotive drug administrationport-access coronary bypass surgeryprimary subtractive color for lightislamic great eastern raiders-frontgeorges eugene benjamin clemenceauislamic jihad movement in palestinemaxwell-boltzmann distribution lawfemale internal reproductive organrank-order correlation coefficientoscar fingal o'flahertie wills wilde
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (54)
nikolai andreyevich rimski-korsakovafrican american vernacular englishpeople against gangsterism and drugspatent and trademark office databasedepartment of the federal governmenthierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyintercontinental ballistic missilestraight-line method of depreciationrevolutionary justice organizationobject-oriented programing languagecount nikolaus ludwig von zinzendorfnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory drugisidore auguste marie francois comteuniversity of california at berkeleymarcus aurelius valerius maximianusprimary subtractive colour for lightnational liberation front of corsicatheory of electrolytic dissociationketosis-resistant diabetes mellitusinsulin-dependent diabetes mellituscockcroft-walton voltage multiplierroberto francesco romolo bellarmineelectronic counter-countermeasuresedmond louis antoine huot de goncourtoculopharyngeal muscular dystrophylymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenkowilhelm apollinaris de kostrowitzkiindependent state of papua new guineatyrannus domenicensis domenicensis
...View all with 32 letters...
Phrases (45)
characteristic root of a square matrixlinear-quadratic-gaussian controllermusical instrument digital interfaceautonomous sensory meridian responsebreach of trust with fraudulent intentinternational maritime organizationstandard generalized markup languageepistle of paul the apostle to philemoncongress of industrial organizationslycopersicon esculentum cerasiformeobject-oriented programming languagemusculus abductor digiti minimi pedisbureau of alcohol tobacco and firearmsorganization of the oppressed on earthmusculus obliquus externus abdominispityrogramma calomelanos aureoflavaelizabeth cleghorn stevenson gaskellnondepository financial institutionprivilege against self incriminationmusculus sphincter ductus choledochilaser-assisted in situ keratomileusisgeneral agreement on tariffs and tradesir winston leonard spenser churchillright to speedy and public trial by juryfinancial crimes enforcement networkkonstantin sergeyevich stanislavskydisease of the neuromuscular junctionmercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyeconomic commission for latin americainternational law enforcement agencycapital: critique of political economypositron emission tomography scanner
...View all with 33 letters...
Phrases (42)
jacques francois fromental elie halevyrelational database management systemconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal islamic republic of the comorosfederal national mortgage associationacademy of television arts and sciencesepistle of paul the apostle to the romansgeorge louis palmella busson du mauriernero claudius caesar drusus germanicuscosmic microwave background radiationinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzkolmogorov's strong law of large numberseuropean law enforcement organisationvena centralis glandulae suprarenalisfunctional magnetic resonance imaginghermann ludwig ferdinand von helmholtzdryopithecus rudapithecus hungaricusclostridium perfringens epsilon toxinfour-stroke internal-combustion engineprince otto eduard leopold von bismarckmassachusetts institute of technologyfederal deposit insurance corporationeconomic and social council commissionfederal home loan mortgage corporationerasable programmable read-only memorydepartment of health and human servicesassociation of southeast asian nationstiberius claudius nero caesar augustusforeign intelligence surveillance actbaron hugh caswall tremenheere dowdingeinstein's general theory of relativityeinstein's special theory of relativity
...View all with 34 letters...
Phrases (33)
national baseball hall of fame and museumnational technical information servicejohann christoph friedrich von schillercommunications security establishmentinternational development associationunited states postal inspection servicetadeusz andrzej bonawentura kosciuszkorevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycomte donatien alphonse francois de sadecanadian security intelligence serviceimmaculate conception of the virgin marymaxmillien marie isidore de robespierrehereditary motor and sensory neuropathycockcroft and walton voltage multipliernational socialist german workers' partychristopher william bradshaw isherwoodimmigration and naturalization serviceanti-imperialist international brigadequintus septimius florens tertullianusfederal democratic republic of ethiopiatransurethral resection of the prostatefederal law enforcement training centerdepartment of defense laboratory systemballistic missile defense organizationnon-insulin-dependent diabetes mellitussubacute sclerosing leukoencephalitisselective-serotonin reuptake inhibitorfraxinus pennsylvanica subintegerrimasecurity intelligence review committeeproduct-moment correlation coefficientunited states naval research laboratoryPhrases (27)
center for disease control and preventionrank-difference correlation coefficientjakob ludwig felix mendelssohn-bartholdysecretary of state for the home departmentangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewiialbert francis charles augustus emmanueltransportation security administrationinternational association of lions clubssecretary of health education and welfarecriminal intelligence services of canadaalbrecht eusebius wenzel von wallensteinnatural language processing applicationtiberius claudius drusus nero germanicussocialist people's libyan arab jamahiriyavenae dorsales clitoridis superficialesbaron karl maria friedrich ernst von weberdeclining balance method of depreciationpublius cornelius scipio africanus majornaval air warfare center weapons divisionunited states government printing officePhrases (26)
severe combined immunodeficiency diseasesisters of the order of saint basil the greatfirst epistle of paul the apostle to timothyunited states declaration of independencetheodore roosevelt memorial national parkketoacidosis-resistant diabetes mellitusuniversity of north carolina at chapel hillattention deficit hyperactivity disordercentre for international crime preventiondemocratic and popular republic of algeriagenerally accepted accounting principlesdemocratic socialist republic of sri lankatrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and sciencesdepartment of health education and welfarekarl friedrich hieronymus von munchhausendefense advanced research projects agencyepistle of paul the apostle to the ephesiansepistle of paul the apostle to the galatiansus army criminal investigation laboratorycongregation of the sisters of saint hedwigsixteen personality factor questionnairesupreme headquarters allied powers europeunited states national library of medicinePhrases (13)
general certificate of secondary educationunited states government accounting officeobject-oriented database management systemsecond epistle of paul the apostle to timothyalexis charles henri maurice de tocquevilledemocratic republic of sao tome and principeinternational civil aviation organizationeconomic commission for asia and the far eastmarie joseph paul yves roch gilbert du motierdepartment of housing and urban developmentadvanced research and development activityepistle of paul the apostle to the colossiansminimally invasive coronary bypass surgeryPhrases (14)
million floating point operations per secondbillion floating point operations per secondrussian soviet federated socialist republicdefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencerespiratory distress syndrome of the newborngates of the arctic national park and preservenucleoside reverse transcriptase inhibitorpopular front for the liberation of palestinefuerzas armadas revolucionarios de colombiabaron hermann ludwig ferdinand von helmholtzepistle of paul the apostle to the philippiansenzyme-linked-immunosorbent serologic assayPhrases (13)
nicotinamide adenine dinucleotide phosphateassociation of islamic groups and communitiesminnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleinational archives and records administrationprayer of azariah and song of the three childrenlaser-assisted subepithelial keratomileusisregents of the university of california v. bakkerussian soviet federative socialist republicinternational relations and security networkursulines of mary immaculate virgin of gandinofirst of october antifascist resistance grouptrillion floating point operations per secondPhrases (7)
national aeronautics and space administrationorganization of petroleum-exporting countriesnational institute of standards and technologyfirst of october anti-fascist resistance groupsoccupational safety and health administrationship-towed long-range acoustic detection system5-hydroxy-3-methylglutaryl-coenzyme a reductasePhrases (7)
pearson product-moment correlation coefficientarmy high performance computing research centerpaul ludwig von beneckendorff und von hindenburgbasal body temperature method of family planningdemocratic front for the liberation of palestinenon-nucleoside reverse transcriptase inhibitorbaron friedrich heinrich alexander von humboldtPhrases (9)
revolutionary organization of socialist muslimsnational oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systeminternational society for krishna consciousnessPhrases (7)
abul-walid mohammed ibn-ahmad ibn-mohammed ibn-roshdassociation for the advancement of retired personsprayer of azariah and song of the three holy childrengeorges leopold chretien frederic dagobert cuvierconte alessandro giuseppe antonio anastasio voltafirst epistle of paul the apostle to the corinthiansunited states army criminal investigation commandPhrases (8)
international bank for reconstruction and developmentnineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundroyal society of london for improving natural knowledgeunited society of believers in christ's second appearing