Words Containing: E,A,K
(In Any Order)
There are 6,524 words,
4,457 phrases and
4 abbr's with
E,A,K in.
Best Scoring Words With: E,A,K
More words | |||||||
---|---|---|---|---|---|---|---|
Rank | Word | Save? | Length | Usage | Points | Type | |
1 | squeaky | 7 | 23 | adjectiveadj | |||
2 | kyanize | 7 | 23 | verbv | |||
3 | zelkova | 7 | 23 | nounn | |||
4 | khazens | 7 | 23 | nounn | |||
5 | quacked | 7 | 23 | verbv | |||
6 | pickaxe | 7 | 22 | verb, nounv, n | |||
7 | khazen | 6 | 22 | nounn | |||
8 | pajocke | 7 | 22 | ||||
9 | quacker | 7 | 22 | nounn | |||
10 | quackle | 7 | 22 | verbv | |||
or scroll down to see all results... | |||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (396)
market12jacket19packed15koreanparker12makeup14walker13parked13marked13basket12brakes12karate10backed15banker12freaky16racket12yankeesoaked11packet14bakery15stakes10marker12tackle12shaken13sneaky13streak10awaken13masked13hacker15squeak19remark12sacked13skater10casket12talker10
...View all with 6 letters...
Phrases (10)
tab keytake onpoke attake topeck atred oakwake uprake inrake upmake itWords (709)
mistake13package16blanket13cracked16freaked15karaoke15speaker13denmarktracked14stalker11breaker13whacked20pancake15peacock17sparkle13breakup15tracker13ukrainestacked14cupcake17takeoff17setback15squeaky23forsake14kendallanklets11stalked12seasick13starkeybarkleyslacker13takeout11partake13cloaked14leakage12
...View all with 7 letters...
Phrases (61)
like madski racecake mixknee padeye masktax hikeleak outtake forback endbreak upask overdark redtaken uplake bedhot cakesea duckdie backsea kalesea kingde bakeytie racktie tacksea pinkbear oakpark ave.hen hawkpep talkkey palmlive oaka kempissneak incake tinsneak upoil cakeeye bank
...View all with 7 letters...
Words (1049)
speaking15breaking15darkness13mistaken14necklace16weakness15nickname16sneaking13creaking15sneakers12sidewalk16panicked17crackers16keyboard18comeback20feedback20paycheck24backside17teamwork17awakened16attacker14forsaken15outbreak14yearbook17takeover15overtake15weakened16backbone18maverick19makeover17nebraskaskinhead16wreckage18stakeout12backseat16
...View all with 8 letters...
Phrases (173)
paul kleepipe rackkite tailsea wrackkeep backark shellcorn cakereap hooktake a bowbank notetax breaktake a hoptake armstake backmake goodmake growlean backmake overmake puremake suremap makerweak partwine caskeasy markakee treebike racenews leakmauna keafish cakespeak forspeak outtea breaklake kivutea makerlake mead
...View all with 8 letters...
Words (1234)
breakfast18kidnapped19paperwork20marketing16breakdown19squeaking23backstage18kidnapper18sheldrake17caretaker15filmmaker20handshake20moonraker15skinheads17talkative16workplace20checkmate22speakeasy18horseback20spokesman17awakening17taekwondo17trademark16skeptical17mackenzieundertake14fruitcake18racetrack17blockhead21knackered20nicknamed18framework21backwater20weakening17milwaukee
...View all with 9 letters...
Phrases (314)
little aukboot makerfilm makerlake nyasagreat skuatank shellspace walktask forcedisk shapeadam's peakair jacketlike crazybone blackbulk largesketch maptalk termsrank orderrisk takerjockey caprain checkchoke backfast breakblack beadblack bilebeer makerpay packetangel cakekeep relaykeep trackpike's peakhave a lookknee bracebook agenttable talkant shrike
...View all with 9 letters...
Words (1042)
basketball18remarkable18earthquake26skateboard17remarkably21undertaker15goalkeeper17heartbreak19cheesecake21blackberry23cheapskate21sauerkraut14mistakenly19skyscraper21nutcracker18matchmaker23painkiller16bricklayer21jackhammer30cornflakes19dressmaker17steakhouse17gatekeeper17gamekeeper19lumberjack27trafficker22embankment20backstreet18waterworks20overtaking18lawbreaker19pawnbroker21linebacker18dreadlocks18jawbreaker26
...View all with 10 letters...
Phrases (390)
swage blockoff-the-rackmary leakeydisk accesshard workerskagen oddeline backerlake nassersponge cakeslack waterstrike hardeccles cakegenus khayabear marketprayer bookshish kebabsnake venomtalk turkeyyard markerphrase bookpawn ticketkey patternsmart aleckjerked meatpigeon hawkjohnny cakeherman woukpalm kernelscarlet oakjakob bohmeedmund keanskiing racecarpet tacksneak thiefblack death
...View all with 10 letters...
Words (862)
shakespearesupermarket19acknowledge22quarterback28heartbroken20unthinkable20marketplace21godforsaken20undertaking17loudspeaker18unspeakable19knucklehead25blackmailer21unbreakable19firecracker22hypermarket25bakersfieldrattlesnake15safekeeping21sleepwalker20kierkegaardcandlestick20awkwardness22crackerjack32floorwalker21wastebasket20backstabber23peacekeeper21tutankhamenperestroika17unspeakably22metalworker20sweepstakes20unshakeable20speechmaker24
...View all with 11 letters...
Phrases (443)
tribal sheiklouis leakeyskagens oddecrank handlebarrel makermax delbrucknikola teslaflower stalkstrike a blowhockey coachglossy snakewinter breakdasht-e-kavirgreater kudutruck dealerdrain basketbanded kraitalkali metallike royaltyelapid snakegenus krigiashell jackettalking headair sicknessgene linkagepolicy makermackerel skypatch pocketribbon snakekeep an eye ongarden truckbearer stockalkyl halidecentral parkbuck private
...View all with 11 letters...
Words (503)
kindergarten18handkerchief28breakthrough25frankensteintroublemaker20breathtaking22acknowledged24sleepwalking22unmistakable20heartbreaker21kaleidoscope21straitjacket25thessalonikiracketeering19jacksonvillespeakerphone23unremarkable20speechmaking26kleptomaniac22frankincense21cantankerous18streetwalker19czechoslovakskateboarder19peacekeeping23breaststroke18saskatchewanhyperkalemiametalworking22crackbrained23packinghouse24masterstroke18thankfulness22turkmenistancabinetmaker22
...View all with 12 letters...
Phrases (408)
trouble makertribal sheikhlake michiganbackspace keytea-like drinkfrancis drakehockey leaguekitchen rangecarving knifemountain bikelike an expertgenus makairabarbecue forkkuvi languageshelf bracketimmanuel kantcaesium clockernst haeckelcardioid mikejohn van vlecksecond sackerarrester hookalaska nativebattle of wakemerchant bankground tacklemasking papergarden rocketmasking piecemountain peaklurking placeozark plateaukonrad lorenztree kangaroohorse blanket
...View all with 12 letters...
Words (263)
knowledgeable24heartbreaking23counterattack21skateboarding21acknowledging25kapellmeister21shakespeareanbackscratcher28sportsmanlike21brokenhearted23telemarketing20marketability24leatherjacket29kaffeeklatsch32gentlemanlike20streetwalking21housebreaking23anticlockwise24troublemaking22strikebreaker23talkativeness20statesmanlike19chameleonlike24streptokinase19shakespeariankindergartner19unmistakeable21kaleidoscopic24groundbreaker21cabinetmaking24holidaymakers26kleptomaniacs23knowledgeably27rekeyboarding24spaghettilike23
...View all with 13 letters...
Phrases (417)
bakke decisionel iskandriyahremovable diskgrass parakeetwhite backlashyakut languageknud rasmussenalistair cookebabe didriksonskeletal frametomato ketchupjekyll and hydekazak languagechicken manurechristmas cakedrinking watertelephone jacksurgical knifekamba languagealkaline metalbenjamin spockbrassica kaberalaska fur sealturkey buzzardrudaceous rockalexander blokblack americanblack-and-whitekong the masterkongo languageparking ticketfactory workerkangaroo mouseshock absorberroller skating
...View all with 13 letters...
Words (140)
czechoslovakiagroundbreaking23acknowledgment27straightjacket31unacknowledged26chickenhearted29unthankfulness24kindergartener20disembarkation23omphaloskepsis27strikebreakers24hyperkeratotic28kapellmeisters22groundbreakers22straitjacketed28omphaloskepses27housebreakings24taskmistresses20phytoplankters28ankylosauruses21quarterbacking32troublemakings23cabinetmakings25thankfulnesses24breathtakingly27counterattacks22semidarknesses21backscattering25brackishnesses25hyperkeratoses26hyperkeratosis26earthshakingly28prankishnesses23heterokaryoses24heterokaryosis24
...View all with 14 letters...
Phrases (401)
weather outlookkissing diseasecircuit breakeranthony vandykesir joseph banksmarkup languagekitchen cabinetsmall livestockgeorge s. kaufmanemergency brakecapital of kenyagarboard strakeblackberry bushskeletal systemstephen hawkingaround-the-clockstephen leacockkazakh languagecock-a-doodle-doochicken scratchbenjamin tuckerkechua languagekwajalein atollstinking wattletalking picturegeorgia o'keeffearthur koestlerkonrad adenauerkangaroo jerboadynamic speakersurprise attackintake manifoldkeynote addresssouth korean wonservice cutback
...View all with 14 letters...
Words (96)
acknowledgement28unsportsmanlike23czechoslovakianheartbreakingly28kindheartedness24kinesthetically27prekindergarten23acknowledgments28kaffeeklatsches34plainspokenness23straitjacketing29ankylostomiases24thanklessnesses22counterblockade26backscatterings26musculoskeletal23strikebreakings26marketabilities23leukaemogeneses22leukaemogenesis22disembarkations24keratinizations28stockbrokerages28unknowledgeable26unworkabilities24straightjackets32pharmacokinetic30unknowabilities24mountebankeries23telekinetically24microearthquake35thinkablenesses24kindergarteners21phenylketonuria27heartsicknesses24
...View all with 15 letters...
Phrases (353)
dame muriel sparkbattle of okinawain all likelihoodkoasati languagecanakkale bogazipinchas zukermanerlenmeyer flaskarikara languagegenus katsuwonussnake in the grassmanner of walkingkechuan languagemask of pregnancywholesale marketmountain hemlockalaskan malamuteattack submarineinsurance brokerbeefsteak tomatocommonplace bookrainbow lorikeetturkish languageappointment bookturkmen languagekannada languageking camp gilettehooded sheldrakebokmaal languageautomobile trunkkhalkha languagebadminton racketcapital of turkeyhorseback ridingalfred hitchcockalbizzia lebbeck
...View all with 15 letters...
Words (23)
heterokontophytaunthinkabilitieskinaestheticallypharmacokineticsstraightjacketedphenylketonuriasprekindergartensacknowledgementsremarkablenessesjapanese-speakingwrinkle-resistantcantankerousnessheterokaryosisesmicroearthquakescounterattackerscounterattackingcounterblockadedniger-kordofaniancounterblockadeslivonian-speakingkrypterophaneronantiracketeeringknowledgeabilityPhrases (278)
dame kiri te kanawastrictly speakingaleksandr borodincaptain james cookhypophyseal stalkgeorge walker bushblackboard eraserbenjamin franklinamerican woodcockshortbread cookiekwakiutl languagecapital of new yorkalaskan brown bearkanarese languagefriendly takeovernew greek languagealexander pushkinalexander selkirkismoil somoni peakgeneral knowledgedisease of the skinrainer maria rilkenooks and cranniesbroad buckler-fernark of the covenantturkoman languagesoren kierkegaardwest coast hemlockbank commissionerprince of darknessfamily gekkonidaegenus agkistrodonkhirghiz languagekingdom of denmarkcanebrake rattler
...View all with 16 letters...
Words (14)
triskaidekaphobiaknowledgeablenesskaleidoscopicallyleukoencephalitiskindheartednessesicelandic-speakingstraightjacketinggentlemanlikenesstriskaidekaphobicsamoyedic-speakingcounterblockadingthreskiornithidaebrokenheartednessplainspokennessesPhrases (242)
mount kanchenjungakiswahili languagenikolaas tinbergenswallow-tailed kitealeksandr scriabincapital of kentuckyhorned rattlesnakerobert ranke gravescrookes radiometerblackfoot languagecapital of nebraskaabkhasian languagebeefsteak geraniumalexander kerenskychinookan languagedunkirk evacuationsackcloth and ashesgreek monetary unitburning at the stakesubkingdom metazoaeugene curran kellyjaroslav heyrovskyoncorhynchus nerkavirginia snakeroothook line and sinkerbuttermilk pancakecommutation ticketmake vibrant soundscompact-disk burnercharles f. ketteringbooker t. washingtonmark the evangelistandrei voznesenskyoff the beaten trackfrederick douglass
...View all with 17 letters...
Words (6)
knowledgeabilitiesgedankenexperimenttriskaidekaphobiascantankerousnessespocket-handkerchiefcaterpillar-trackedPhrases (202)
double-deck carriagedame sybil thorndikebackspace characterrefrigerator cookiegeorge simon kaufmanvictor frankensteinbattle of tewkesburyintervertebral diskkamchatka peninsularepublic of kiribatialkaline-earth metalstinking nightshadebattle of wake islandeuropean goatsuckerrudbeckia laciniatacalifornia white oakkeyboard instrumentparkinson's syndromecakchiquel languageanton van leuwenhoekhablot knight brownefrankliniella fuscabook of common prayermake a clean breast ofalfred louis kroebereastern ground snakebook of lamentationsjons jakob berzeliuskarl friedrich gaussedward lee thorndikeduck-billed dinosaurduckbilled platypusgrace patricia kellysalt lake tabernacleanagasta kuehniella
...View all with 18 letters...
Words (5)
knowledgeablenessesgedankenexperimentsgentlemanlikenessesphosphofructokinasemakataimeshekiakiakPhrases (150)
shakespearean sonnetmeat-packing businesshandle with kid gloveseuropean central bankvalentina tereshkovakuwaiti monetary unitjapanese honeysucklecapital of north koreaanti-takeover defensealben william barkleyturkmen monetary unitcapital of south koreagerard manley hopkinsanton van leeuwenhoekdibranchiate molluskprince fumimaro konoecapital of the ukrainenetwork architecturetrans-alaska pipelinemickey charles mantlewhite-leaved rockrosemartin luther king daybattle of bannockburnbattle of chickamaugabaroness karen blixenkate o'flaherty chopinignace jan paderewskispoken communicationjean-baptiste lamarckkatherine anne portereskimo-aleut languageembryoma of the kidneygreat smoky mountainsdisk operating systemlepidothamnus fonkii
...View all with 19 letters...
Words (3)
keratoconjunctivitesphosphofructokinaseskeratoconjunctivitisPhrases (122)
black-capped chickadeeyellow-shafted flickerappendicular skeletonwilliam wilkie collinssir karl raimund popperstephen butler leacockfriedrich alfred kruppuniversity of nebraskarepublic of kazakhstanernst heinrich haeckelmechanically skillfulhendrik petrus berlagehugo alvar henrik aaltofrankenstein's monsteranton pavlovich chekovbread and butter pickleeastern turki languageukranian monetary unitalice malsenior walkermarket capitalisationjohn kenneth galbraithprotective embankmentten-spined sticklebackyellow-leaf sickle pinedwarf golden chinkapinblack-footed albatrosspsychopsis kramerianahemlock water dropwortmock turtleneck collarchinese black mushroomboykinia occidentalismetrazol shock therapynerve block anesthesiapellicularia kolerogatraditional knowledge
...View all with 20 letters...
Words (1)
alkylbenzenesulfonatePhrases (107)
aleksandr solzhenitsynbillie jean moffitt kingstephen william hawkingsri lankan monetary unitketorolac tromethaminesmallmouthed black bassklebs-loeffler bacillusisle royal national parkkonrad zacharias lorenzanton pavlovich chekhovantonie van leeuwenhoeksoren aabye kierkegaardcapital of turkmenistanbank-depositor relationpakistani monetary unitknight of the round tablesir alexander mackenziejack roosevelt robinsoncharles frederick worthjohn fitzgerald kennedythomas kennerly wolfe jr.battle of lake trasimenewilliam schwenk gilbertspeaker identificationerik alfred leslie satieschlumbergera buckleyimusculoskeletal systemkurdistan workers partykurdistan workers' partyatrioventricular blockamerican stock exchangenerve block anaesthesiaatrioventricular trunkthin-leaved stringybarkbabe didrikson zaharias
...View all with 21 letters...
Words (2)
keratoconjunctivitideskeratoconjunctivitisesPhrases (69)
aleksandr i. solzhenitsynsir laurence kerr olivierjohn ronald reuel tolkienbattle of the bismarck seagreek war of independenceedward kennedy ellingtonjohn davison rockefelleralpha-adrenergic blockerbattle of fredericksburgjan evangelista purkinjeblack-crowned night heroncharlotte perkins gilmanpearl sydenstricker buckblack-fronted bush shrikeeverglades national parkhydraulic brake cylinderblack-stemmed spleenwortmetrazol shock treatmentarchidiskidon imperatordiamondback rattlesnakeplantation walking horsebenjamin franklin bridgeernestine schumann-heinkbyzantine greek languageeuropean fly honeysucklebrassica rapa pekinensiscrater lake national parkgroundbreaking ceremonyisle royale national parkboris vasilevich spasskyshenandoah national parkwar of greek independencegrand teton national parkfrank winfield woolwortherskine preston caldwell
...View all with 22 letters...
Phrases (66)
family threskiornithidaetransient ischemic attacknikolai vasilievich gogolyellowstone national parkkazakhstani monetary unitlewis and clark expeditionsarvepalli radhakrishnankyrgyzstani monetary unitdorothy rothschild parkersouth korean monetary unitunlawful carnal knowledgetyrosine kinase inhibitortajikistani monetary unituzbekistani monetary unitwilliam cuthbert faulknerkingdom of the netherlandsletter of mark and reprisalyuri alekseyevich gagaringeorge herbert walker bushdame kiri janette te kanawaauto-blocking belay devicecount maurice maeterlinckbryce canyon national parkmammoth cave national parkkobuk valley national parkbattle of the caudine forksbenjamin ricketson tuckerfriedrich august von hayekislamic party of turkestantheory of weak interactionicterus galbula bullockiicreutzfeldt-jakob diseasewernicke's encephalopathyjakob-creutzfeldt diseasefranklin delano roosevelt
...View all with 23 letters...
Phrases (47)
louis seymour bazett leakeydivision heterokontophytarichard buckminster fullerequus caballus przewalskiibahasa kebangsaan languagecharles john huffam dickensandrei andreyevich gromykomax karl ernst ludwig planckhashemite kingdom of jordanmount rainier national parkmaxfield frederick parrishaleksey maximovich peshkovfrancis henry compton crickbenjamin franklin norris jr.counterclockwise rotationislamic group of uzbekistanketosis-resistant diabetespartiya karkeran kurdistanblack and gold garden spiderbattledore and shuttlecocknickel-cadmium accumulatoranatoli yevgenevich karpovjohann joachim winckelmannwireless local area networkarcuate artery of the kidneyequus caballus przevalskiibank identification numbersoutheastern pocket gopherlucy in the sky with diamondshuman t-cell leukemia virus-1domesticated silkworm mothayatollah ruholla khomeinicharles christopher parkerdavid lewelyn wark griffithniger-kordofanian language
...View all with 24 letters...
Phrases (35)
cosmic microwave backgroundfrancis scott key fitzgeraldboris leonidovich pasternakrudolf christian karl dieselsaddam bin hussein at-takrititrans-alaska pipeline systempyotr alexeyevich kropotkincharles frederick menningerandrei arsenevich tarkovskybronislaw kasper malinowskipodkamennaya tunguska rivercygnus columbianus bewickiiangus frank johnstone wilsonaleksey maksimovich peshkovketoacidosis-prone diabetesmikhail yurievich lermontovsecond marquis of rockinghamislamic republic of pakistanrank-difference correlationjoint direct attack munitionchamaecyparis nootkatensiscapital of the united kingdomvon recklinghausen's diseasechronic myelocytic leukemiafederal home loan bank systemhenry kenneth alfred russellcommunist party of kampucheabruckenthalia spiculifoliaperiwinkle plant derivativerashtriya swayamsevak sanghnorth cascades national parkwilliam makepeace thackeraybranched chain ketoaciduriakeratoderma blennorrhagicarocky mountain spotted feverPhrases (29)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkx-linked dominant inheritancesir sarvepalli radhakrishnanlassen volcanic national parkkarl rudolf gerd von rundstedtemployee stock ownership planbooker taliaferro washingtonandrei dimitrievich sakharovcockcroft-walton acceleratoralexander alexandrovich blokparty of democratic kampucheaoncidium papilio kramerianumjohannes diderik van der waalschronic lymphocytic leukemiaeastern red-backed salamanderunited mine workers of americasir frederick gowland hopkinswestern red-backed salamanderbaron richard von krafft-ebingneuromuscular blocking agentacute lymphoblastic leukemiablack september organizationbaroness jackson of lodsworthbaroness thatcher of kestevenfrederick william i of prussiakathleen mansfield beauchamppresident franklin rooseveltPhrases (38)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkindirector-stockholder relationbeta-adrenergic blocking agentjerusalem artichoke sunflowertaras grigoryevich shevchenkosir frederick william herschelaleksandr aleksandrovich blokfalkland islands monetary unitnikolai ivanovich lobachevskyaleksandr porfirevich borodinx-linked recessive inheritancemikhail sergeyevich gorbachevkazimir severinovich malevichuniversity of nebraska-lincolngeorgi konstantinovich zhukovrudbeckia laciniata hortensiawrangell-st. elias national parkpetrified forest national parkjohannes evangelista purkinjeradioactive iodine uptake testhawai'i volcanoes national parkhawaii volcanoes national parkindustrial workers of the worldpleuropneumonialike organismkennedy international airportmujahidin-e khalq organizationeysenck personality inventorymartin luther king jr's birthdaywilliam iv of the united kingdombaron karl wilhelm von humboldtkepler's law of planetary motionmaurice hugh frederick wilkinscarlsbad caverns national park
...View all with 27 letters...
Phrases (21)
aleksandr feodorovich kerenskystrategic arms limitation talksfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskymicrosoft disk operating systemfeodor mikhailovich dostoevskifeodor mikhailovich dostoevskysergei mikhailovich eisensteinfrederick william iii of prussiacount lev nikolayevitch tolstoymikhail aleksandrovich bakuninmildred ella didrikson zahariasgates of the arctic national parkkonstantin sergeevich alekseevkaposi's varicelliform eruptioneast turkestan islamic movementeast turkistan islamic movementfirst earl kitchener of khartoumpatrick victor martindale whitealpha-adrenergic blocking agentrocky mountain bristlecone pineWords (1)
hexakosioihexekontahexaphobiaPhrases (18)
aleksandr nikolayevich scriabindmitri dmitrievich shostakovichkatmai national park and preservetheodore roosevelt national parkstephanus johannes paulus krugerlydia kamekeha paki liliuokalaniketoacidosis-resistant diabetescockcroft and walton acceleratorfyodor mikhailovich dostoyevskygrigori aleksandrovich potemkinalfred habdank skarbek korzybskiprince william, duke of cumberlandfeodor mikhailovich dostoyevskykendall partial rank correlationteodor josef konrad korzeniowskiwestern diamondback rattlesnakedenali national park and preservevyacheslav mikhailovich molotovPhrases (14)
nikolai andreyevich rimski-korsakovpatent and trademark office databaseweakly interacting massive particlesergei aleksandrovich koussevitzkycount nikolaus ludwig von zinzendorfnikolai andreyevich rimsky-korsakovuniversity of california at berkeleyketosis-resistant diabetes mellituscockcroft-walton voltage multiplieryevgeni aleksandrovich yevtushenkowilhelm apollinaris de kostrowitzkidemocratic people's republic of koreajohn f. kennedy international airportlake clark national park and preserve