Words Containing: _I
(In Exact Order)
There are 172,747 words,
44,799 phrases and
266 abbr's with
_I in.
Best Scoring Words With: _I
More words | |||||||
---|---|---|---|---|---|---|---|
Rank | Word | Save? | Length | Usage | Points | Type | |
1 | pizzazz | 7 | 45 | nounn | |||
2 | pizazzy | 7 | 39 | adjectiveadj | |||
3 | pizazz | 6 | 35 | nounn | |||
4 | quizzed | 7 | 35 | verb, adjectivev, adj | |||
5 | jazzily | 7 | 35 | adverb, adjectiveadv, adj | |||
6 | pizzaz | 6 | 35 | nounn | |||
7 | zizzled | 7 | 35 | verbv | |||
8 | bizazz | 6 | 35 | nounn | |||
9 | zizzing | 7 | 35 | verbv | |||
10 | quizzes | 7 | 34 | nounn | |||
or scroll down to see all results... | |||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (192)
him8did5his6ain3sir3big6die4bit5sit3kid8hit6six10win6lie3air3fix13fit6rid4pig6oil3tie3dig5sin3jin10tip5pie5hip8rip5mix12aim5aid4sis3hid7chi8bin5
...View all with 3 letters...
Abbreviations (69)
aliminfbimeirioqinbaiweilivisitiaguipeitiudixmitdcikuimriiiigialironidiafriepiciaroidoiaixtibvipviioisxxi
...View all with 3 letters...
Words (1152)
this7with10like8will7time6give8said5life7wait7find8nice6girl5fine7kind9live7mind7wife10miss6five10mine6high11side5wish10fire7city9line4sick10pick12hair7king9film9sing5till4sign5kiss8
...View all with 4 letters...
Phrases (11)
cu into iton ita bitdo indo itsq inbig hli poleo igo inAbbreviations (184)
ninathairicotitootisohiomarilizanilepittfinnsamidevihaninikediazqingxianmeirodinmiaolevigitareiddiascliokievzionfijikwaimaiaisissitasiamsiva
...View all with 4 letters...
Words (3723)
right9think12going7doing7first8thing9again6still5their8night9which16being8might11bring8since7while11drink10until5times7music9child11point7fight12quite14light9tried6alive8white11write8drive9lives8quiet14tired6movie10piece9
...View all with 5 letters...
Phrases (55)
zip upget iton airput intip ini. m. peifix upe. coliset inbuy inbuy itsow inget inpara ipin onrip upkit uphip tootto ipius vpius xrig upto witpig itg suitout inpop infit inall inbo haidig indig upfig upli baileg it
...View all with 5 letters...
Abbreviations (1)
calif.Words (8406)
little6things10listen6coming11friend10family14trying10police10saying10inside7having13sister6minute8taking11afraid10making13behind12living10either9office14dinner7asking11finish12ladies7seeing7moving12giving11during8choice13single7middle10simple10christfigure10crying12
...View all with 6 letters...
Phrases (228)
air bagcup tiewild oxkit outhip padrail intin earpipe infire uprise uprope inair outcow pieon fireslip bysign inline upcage int hingepen nibin kindzoom inski runlive inkeep instir uplive onsink inlock inquite abig benseal inpick upbig catdig out
...View all with 6 letters...
Words (16384)
nothing11believe12talking12looking12without13getting9morning10tonight11working15waiting11minutes9married10against8alright11outside8promise11serious7leaving11playing13telling8feeling11special11million9running8himself15evening11meeting10finally13calling10picture11captain11explain16kidding14forgive14wedding13
...View all with 7 letters...
Phrases (629)
air basedie downair cellpin curldrill inmail outcon brioair ductsea lilyair flowusing upin briefdrink upair holeair hornair hoselie downget wiserange intie downcut intoair mailcow lilydin landdivvy upchain upblend inlike madfin keeldrip panedit outair pumpgin millair raidde vries
...View all with 7 letters...
Abbreviations (1)
lgbtqia+Words (22991)
anything15business10thinking16children14question17hospital13possible12straight12birthday17laughing13finished15watching17building12americanaccident13marriage11speaking15security13terrible10sleeping11surprise10continue10evidence14fighting16standing10position10promised13starting9drinking14director11decision11princess12military13shooting12favorite14
...View all with 8 letters...
Phrases (1169)
white antold irishauto tirefilm clipw. c. fieldsfilm fernold latinfield hutfish luregeorge ivdrill bitel qahirastone pitbona fidedisk filehigh signjohn muirair coverby rightsfire ironline feedmail slothigh spotminor keybody suitsieve outcivil warkauri gumfire salesumo ringrail linehead licegill archfree reinin chains
...View all with 8 letters...
Words (26143)
something15beautiful14different16sometimes13happening17president12christmasdifficult18boyfriend18attention9situation9seriously12certainly14beginning13listening10otherwise15screaming14detective15obviously17following16fantastic14according15wondering14apologize21surprised12operation11expensive21recognize21happiness16brilliant11condition12interview15political13delicious12breathing15
...View all with 9 letters...
Phrases (1983)
high pitchstill lifehigh pointlouis kahnmount fujising alongfelis oncalittle aukmanila bayplant lifegenus glisslide boltbitter endbean aphidbon vivantby machinefilm makerslide downaphid liondirect dyedrill hole.45-caliberstar fruitfish slicetidal waveline driveebro riverwhite beerpast timessumming uppaul simongall midgeadam smithtv monitorline judge
...View all with 9 letters...
Words (24974)
everything20girlfriend15definitely17impossible16especially17difference19experience21appreciate16ridiculous13incredible15lieutenant10university16disgusting13downstairs14discovered17television13permission14particular14connection14friendship19protection14considered14production15californiarevolution13washingtonconfidence18punishment17reputation12generation11impressive17chattering16attractive15conditions13collection14
...View all with 10 letters...
Phrases (2804)
fossil fuelshah of iranhindu deityrhone riverstone fruitmarking inkcook straitgenus inuladisk accesshigh reliefbombyx morinavel pointepoxy resincoffee ringdirect costair cleanerline backerdeposit boxcivil rightcubage unitfield judgetidal riverprivate eyegrass skirttv audiencemelting potpast simplefelix kleinjohn napierdrill presssilver cordair currentcaptain bobhigh statusspecial act
...View all with 10 letters...
Words (21796)
information16interesting12immediately19responsible15opportunity18complicated20appointment17competition17coincidence18electricity18imagination14environment16intelligent12explanation20possibility18destruction14anniversary17threatening15personality16considering15experienced23practically20authorities14approaching21differently21forgiveness18fascinating17necessarily16appropriate17complaining18technically21investigate15celebrating16traditional12magnificent19
...View all with 11 letters...
Phrases (3508)
isaac singeraquila rapaxgenus myxinegrass familylaying claimbeam of lightbitter aloescatha edulisleave officehigh profiletribal chiefriding habitflower chainhigh qualitythrough withtribal sheiklaying wastebooster unitboxing matchprairie wolfracing startriding horsefilm editingflower childslide actionbitter cresslouis leakeybreathing inprunus nigrarubbish heapstudio couchbill mauldinsilver berrywilliam tellmighty mouse
...View all with 11 letters...
Words (16820)
relationship17conversation17professional17unbelievable19neighborhood22intelligence15embarrassing17disappointed18construction16organization22particularly19surveillance17instructions14commissioner18championship26psychiatrist22specifically24civilization26presentation14accomplished24accidentally20registration13prescription18constitution14occasionally19transmission14thanksgiving24satisfaction17confidential18psychologist23refrigerator16kindergarten18philadelphiapresidential15entertaining13
...View all with 12 letters...
Phrases (3891)
louis jollietrun-of-the-millpole vaultingelihu thomsonalec guinnessmeasuring rodmortise jointold ironsidesel libertadorpitt the elderfilm directorgoldfish bowlplant kingdomgrain alcoholabelian grouptribal sheikhlarix russicawoody guthrielouis pasteurbusiness firmgrain cleanerserious musicknuckle jointlake michiganmalawi kwachacarniolan beeold line statecover versionotolith organczech capitalallium porrumjan tinbergenmolly pitchergrain sorghumisamu noguchi
...View all with 12 letters...
Words (12212)
investigation17international13understanding16circumstances21extraordinary24entertainment15communication21investigating18consciousness17psychological26revolutionary19demonstration16concentration17approximately29neighbourhood23sophisticated21interrogation14irresponsible17establishment20misunderstood17grandchildren21inappropriate19assassination13consideration16underestimate16environmental18disappearance20automatically20misunderstand17determination16authorization25unpredictable20distinguished19disappointing19inconvenience20
...View all with 13 letters...
Phrases (4147)
john masefieldbakke decisionupton sinclairpartial breachfelis concolorharvey cushingaleatory musicoutside clinchpaul hindemithel iskandriyahfamily laridaeremovable disklarix laricinavaginal arterywhite asbestoswilliam stubbscartridge clipchannel islanddelphic oracledirect antonymgenus struthiobitter cassavamight-have-beenauditory senseblood relationblood relativemeasuring unitfelis pardalislarix sibericawhite backlashmeasuring wormbusiness indexplant materialarcheozoic eonphillips screw
...View all with 13 letters...
Words (8305)
responsibility21administration17communications22representative19identification20transportation16disappointment21recommendation21superintendent17transformation19interpretation16pharmaceutical25simultaneously19representation16rehabilitation19professionally22discrimination19administrative20constitutional16reconstruction18scientifically24reconciliation18characteristic23reconnaissance18unprofessional19czechoslovakiahypothetically30congratulation17accomplishment27claustrophobic25cinematography27circumstantial20archaeological22psychoanalysis27systematically24
...View all with 14 letters...
Phrases (4309)
blood poisoningfamily apiaceaefertilized ovumgalileo galileiimperative formalpine clubmossitalian capitalnegeri sembilanimperative moodpearl mae baileythoracic cavityamphibole groupprotein foldingstrait of calaisimperative verblobe-finned fishcapital of gabonconiferous treedirect contrastseriola grandismarc blitzsteinneutral spiritspier luigi nervigarageman's liengelatin dessertstar divinationkissing diseasemuscular tissuecircuit breakerprivate citizenjacques cartierarterial plaquecapital of ghanaclementine treepaleolithic age
...View all with 14 letters...
Words (5362)
congratulations18electromagnetic22straightforward26psychologically31confidentiality24extraordinarily26revolutionaries18internationally18cinematographer25professionalism22experimentation26unconditionally21insubordination18extracurricular26psychotherapist30unconsciousness19dissatisfaction21methamphetamine29technologically26notwithstanding23unintentionally18synchronization32environmentally23pithecanthropus27underprivileged23decontamination20ophthalmologist26confrontational20personification22entrepreneurial17inappropriately24intussusception19unsophisticated23hospitalization29disenfranchised25
...View all with 15 letters...
Phrases (4060)
malaria parasitemeasuring devicesyringa vulgarisallium carinatumauditory ossiclepanel discussionfelis domesticusby fits and startsstay of executioniridaceous plantkalaallit nunaatcapital of francedame muriel sparkfalco peregrinusseriola dorsalisitalian dressingjunction barrierbenefit of clergybitter chocolateoutside marriagepresident hooverhonduran capitalbusiness expensecapital of gambiastrait of georgiahigh renaissancenewton's first lawalimentary pasteasamiya languagecaltha palustrishelen wills moodycapital of greecemutatis mutandisperfective tensedialysis machine
...View all with 15 letters...
Words (1940)
misunderstandingextraterrestrialincomprehensibleunconstitutionalenthusiasticallyintercontinentalenvironmentalistindiscriminatelydisqualificationautobiographicalanesthesiologistelectromagnetismmultimillionaireirresponsibilitycounterterroristdisproportionateneurotransmittergastrointestinaltransilluminatorundersecretariesconstitutionallytranscontinentalincontrovertiblecounterclockwisehemorrhoidectomycharacterizationmisappropriationincomprehensiblyaustralopithecusenvironmentalismmultidimensionalcounteroffensiveprestidigitationcounterterrorismpseudoscientific
...View all with 16 letters...
Phrases (3492)
hypodermic needletympanic membranemultiengine planecommedia dell'arteczar alexander iiigenus utriculariaarteria vaginalismanihot esculentacapital of finlanddame kiri te kanawaarnica cordifoliamalarial mosquitocapital of floridaatopic dermatitiscartridge ejectorprofessional lifeitalian greyhoundstrictly speakingcapital of georgianeritid gastropodold latin languageperfective aspectdelphinium ajacisfalco tinnunculusgenus angiopterisprivate detectivestrait of magellanzirconium dioxidecartridge removerpresident johnsonproteles cristatafamily cyperaceaechelonian reptilechristian huygensphotographic film
...View all with 16 letters...
Words (1109)
institutionalizedcounterproductiveindistinguishableimmunosuppressionstraightforwardlydepersonalizationtelecommunicationimmunosuppressiveconversationalistcommercializationcounterinsurgencyindustrializationmisinterpretationmisidentificationunconventionalitybacteriologicallytranscendentalisminstitutionalisedmisrepresentationcounterrevolutionconscientiousnesssuperconductivityelectrocardiogramdeconstructionistconstitutionalityelectroconvulsiveanthropologicallycompartmentalizedparathyroidectomyreconstructionismmaterialisticallyreconstructionisttransilluminationchemiluminescenceconsubstantiation
...View all with 17 letters...
Phrases (3199)
horizontal sectioncapital of ethiopiawilliam stricklandcastilian languageobject recognitiongopherus agassiziiheat of sublimationjacqueline cochranmanihot utilissimalarix occidentalismary leontyne pricemount godwin austencompetence hearingdirect correlationaquilegia vulgariskatsushika hokusaidivision bryophytapontederia cordatagenus globicephalastrait of gibraltarsalvia leucophyllabalaena mysticetuscivil rights leaderclomiphene citratejohn moses browningkiswahili languagelandscape paintingophiophagus hannahczech monetary unitacherontia atroposprivate instructorproteolytic enzymemespilus germanicarepublic of armeniasodium bicarbonate
...View all with 17 letters...
Words (586)
telecommunicationscharacteristicallydisproportionatelycompartmentalizinginternationalizinganthropomorphizinginconsequentialityhypercoagulabilitygastroenterologisttransubstantiationoversimplificationtransmogrificationpsychopathologicalspectrophotometricantivivisectionistinstitutionalizinghyperaldosteronismdisenfranchisementoverrepresentationinterchangeabilitysociopsychologicalneuropsychologicalpaleoclimatologistthermoluminescenceunintelligiblenesshypersensitivenesspolyesterificationcoccidioidomycosisexterritorialitieshypersensitivitieshypersensitizationradiochromatogramscommensurabilitiesmisidentificationsspectroheliographs
...View all with 18 letters...
Phrases (2728)
hindu calendar monthbombycilla cedrorunworldly possessionsbusiness enterprisebombycilla garrulusarteria vertebraliswashington monumentoceanites oceanicusdouble-deck carriageprofessional golfererinaceus europaeusrevolutionary groupgenus struthiomimusheat of vaporisationadministrative bodyamerican revolutiontuamotu archipelagodivision anthophytadrafting instrumentheat of vaporizationisabella i of castilepresident jeffersonfamily physeteridaeanamnestic reactionorthotomus sutoriusdame sybil thorndikeprivate corporationeriobotrya japonicaandromeda polifoliascandinavian nationhindustani languagelachrymal secretioncapital of guatemaladivision cynodontiafreudian psychology
...View all with 18 letters...
Words (350)
counterintelligencehyperparathyroidismhydrochlorothiazidesternocleidomastoidpsychophysiologicalpseudohermaphroditeelectroluminescenceintellectualizationcinematographicallystraightforwardnessspectrofluorometricunintelligibilitiesthermoluminescencespolyesterificationsdisenfranchisementsthermoperiodicitieshypersensitizationsextralinguisticallycountersurveillanceextraordinarinessespolyribonucleotidesprofessionalisationotorhinolaryngologyextraterritorialityhypersusceptibilityunpretentiousnessesprofessionalizationantivivisectionistsspectrophotometriesparathyroidectomiesultracentrifugationnonproductivenessessurface-assimilativecommunicativenesseshypolipoproteinemia
...View all with 19 letters...
Phrases (2128)
building supply housewater-plantain familymeasuring instrumentacetylsalicylic acidrecursive definitionfavourable receptionmuscular contractionerinaceus europeaeusallium cepa viviparumaquilegia canadensisbronislaw malinowskifamily cyclopteridaescandinavian countryjohn millington syngesierra madre orientalfamily cynoglossidaerejoicing over the lawcivil rights activistitalian monetary unitsuperior conjunctionhydrastis canadensisallium schoenoprasumlatvian monetary unitlepidopterous insectmillimeter of mercurytheodore harold whitecollective agreementalpine type of glaciercease and desist orderread between the linesantipodal oppositiongiles lytton stracheymicromeria douglasiiphytolacca americanafamily lepisosteidae
...View all with 19 letters...
Words (166)
counterrevolutionaryuncharacteristicallycompartmentalizationinstitutionalizationhypercholesterolemiaanthropomorphizationoverenthusiasticallyinternationalizationtetrahydrocannabinolparadichlorobenzenesspectrofluorometriessemiautobiographicalunintelligiblenesseshypersensitivenessesspectroheliographiespolyphiloprogenitiveradioimmunoassayablekeratoconjunctivitesradiopharmaceuticalscountersurveillancesspectrophotometricalparathyroidectomizedabetalipoproteinemialipochondrodystrophyunrepresentativenesscounter-revolutionistunsatisfactorinessescrystallographicallyreconceptualizationshyperadrenocorticismcomprehensiblenessesindistinguishabilitycounterdemonstrationcytodifferentiationstransformationalists
...View all with 20 letters...
Phrases (1623)
william stanley jevonssuborder strepsirhinisweet-scented geraniumarcheological remainsallium cepa aggregatumblack-capped chickadeecalendula officinalisgilbert charles stuarthonduran monetary unityellow-shafted flickerscandinavian languageappendicular skeletonwyethia amplexicaulisorder mycelia steriliapara aminobenzoic acidprofessional relationdwarf flowering almondfamily phytolaccaceaephotographic emulsionmalawian monetary unitpast progressive tenseinstruction executionlebanese monetary unitwilliam wilkie collinsorder myxobacterialesevergreen bittersweetbusiness organisationmultilinear evolutionlunar excursion modulebusiness organizationsir karl raimund popperfamily trachipteridaesecond coming of christindirect transmissionbusiness relationship
...View all with 20 letters...
Words (61)
psychopharmacologicalhypogammaglobulinemiadisestablishmentarianotorhinolaryngologistextraterritorialitieshypersusceptibilitiescompartmentalizationsinstitutionalizationsstereomicroscopicallymultidimensionalitiesimmunocytochemistriesconstructive-metabolicstraightforwardnessesimmunoelectrophoreticmucopolysaccharidosisestablishmentarianismconstitutionalizationelectrocardiographiesacetylcholinesterasespseudohermaphroditismneuroendocrinologicalneuroendocrinologistsinterconvertibilitiesadrenocorticosteroidsadrenocorticotrophinsotorhinolaryngologiesmeningoencephalitideselectromyographicallybuckminsterfullerenesdendrochronologicallyovercommercializationinternationalizationsimmunoelectrophoresiselectroretinographiesanthropomorphizations
...View all with 21 letters...
Phrases (1233)
use of goods and servicesacrocentric chromosomesir john everett millaisagglutinative languagesierra madre occidentaladministrative hearingelimination tournamentdissolution of marriagesierra nevada mountainsdirect electric currentexperimental conditioncercopithecus aethiopsgasterosteus pungitiushelianthemum scopariumicelandic monetary unitanaphalis margaritaceadiametrical oppositionelaeagnus augustifoliaelectrolytic condensernikolai rimsky-korsakovigor ivanovich sikorskyaleksandr solzhenitsynmalaysian monetary unitanthriscus cereifoliumexecution of instrumentbureaucratic procedurerepublic of cote d'ivoirebattle of soissons-reimshelichrysum bracteatummusculus intercostalisphilosophical doctrineligustrum obtusifoliumbulgarian monetary unitgorilla gorilla gorillaparticular proposition
...View all with 21 letters...
Words (26)
counterrevolutionarieskeratoconjunctivitideskeratoconjunctivitisesdisestablishmentariansspectrophotometricallyunrepresentativenessesnonrepresentationalismimmunohistochemistriesreinstitutionalizationconstitutionalizationsphiloprogenitivenessesintercomprehensibilitydeinstitutionalizationotorhinolaryngologicalotorhinolaryngologistsovercommercializationselectrophysiologicallyhexamethylenetetramineincomprehensiblenessesencephalomyocarditisesdihydroxyphenylalanineestablishmentarianismsindistinguishabilitiesmicrospectrophotometercounterinterpretationsmicrospectrophotometryPhrases (918)
venezuelan monetary unitdisjunctive conjunctionlycopersicon esculentumadministrative districtadministrative divisiongilbert keith chestertongregorian calendar monthprunus persica nectarinahaliaeetus leucorhyphusadministrative officialtransient global amnesiacoronavirus disease 2019posterior nasal apertureredevelopment authorityhydrated aluminium oxidenavigational instrumenttrazodone hydrochloridebarbara wertheim tuchmanleishmaniasis americanaaleksandr i. solzhenitsynsir laurence kerr olivieritalian vegetable marrowviola tricolor hortensisinstrument of punishmentequal-area map projectionfamily dendrocolaptidaejohn ronald reuel tolkienmultiple mononeuropathyfoeniculum vulgare dulceteacher-student relationuniform resource locatorfrancis richard stocktonloyalist volunteer forcepeloponnesian peninsulasubfamily bassariscidae
...View all with 22 letters...
Words (12)
electroencephalographicnonrepresentationalismsreinstitutionalizationsdeinstitutionalizationshexamethylenetetraminesintersubstitutabilitiesoverintellectualizationdichlorodifluoromethaneindistinguishablenesseshypobetalipoproteinemiamicrospectrophotometersmicrospectrophotometricPhrases (642)
gilbert and ellice islandsfamily threskiornithidaeparenthetical expressiontransient ischemic attacktribasic sodium phosphatesecond battle of el alameinposterior pituitary glandchlorpheniramine maleateto all intents and purposesarchibald percival wavellmeperidine hydrochloridenikolai vasilievich gogolsubpoena ad testificandumboeing b-52 stratofortressyellowstone national parkelectromechanical devicesir richard francis burtonaugust wilhelm von hofmannkazakhstani monetary unitcalycanthus occidentalisthryothorus ludovicianusparis-sorbonne universityinterlocutory injunctionpharmacological medicinehippoglossus stenolepsischristoph willibald gluckapium graveolens rapaceumstercorarius parasiticusbrassica oleracea italicaaristolochia serpentariaright of first publicationthiopentobarbital sodiumclassified advertisementsir william rowan hamiltonlewis and clark expedition
...View all with 23 letters...
Words (12)
microgramma-piloselloideslaryngotracheobronchitishyperbetalipoproteinemiaelectrocardiographicallyintercomprehensibilitiesphosphatidylethanolamineelectroencephalographiesmicroelectrophoreticallyoverintellectualizationsdichlorodifluoromethanesmicrospectrophotometriesschizosaccharomycetaceaePhrases (500)
carnegie mellon universityprofessional organisationprofessional organizationlouis seymour bazett leakeylowland burrowing treefrogpelham grenville wodehouseargyroxiphium sandwicensesubdivision deuteromycotadivision heterokontophytamary wollstonecraft godwinunidentified flying objectprivately held corporationtrip the light fantastic toecapture of fort ticonderogazollinger-ellison syndromeprimary sex characteristicbattle of the little bighornsir terence mervyn rattiganbattle of the philippine seabattle of the spanish armadarubus ursinus loganobaccusbrassica oleracea acephalahippoglossus hippoglossusbrassica oleracea botrytisbrassica oleracea capitatadistinguished flying crossfrancois auguste rene rodinadolf otto reinhold windauscapital of northern irelanddmitri ivanovich mendeleevarthur meier schlesinger jr.hunting and gathering tribecucumis melo cantalupensisgottfried wilhelm leibnitzgioacchino antonio rossini
...View all with 24 letters...
Words (3)
immunoelectrophoreticallyphosphatidylethanolaminesantiestablishmentarianismPhrases (352)
count ferdinand von zeppelinunited states secret servicecluster of differentiation 4myroxylon balsamum pereiraecosmic microwave backgroundbureau of justice assistanceigor fyodorovich stravinskybureau of justice statisticsmiguel de cervantes saavedradiamond wedding anniversarymusculus quadriceps femorisfrancis scott key fitzgeraldbattle of the chemin-des-damessymphoricarpos orbiculatuschemical weapons conventioncruel and unusual punishmentbrassica oleracea gemmiferanational science foundationdistinguished service medalfriedrich wilhelm nietzschetherapeutic rehabilitationcentral intelligence agencyfast local internet protocolboris leonidovich pasternakmodest petrovich mussorgskyedmund john millington syngerudolf christian karl dieselpropoxyphene hydrochloridewar of the spanish successiondistribution free statisticproprietorship certificatesecret intelligence serviceantonio allegri da correggiosternocleidomastoid musclepolystichum acrostichoides
...View all with 25 letters...
Phrases (251)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkfrances eliza hodgson burnettshort-spurred fragrant orchidx-linked dominant inheritanceconfederate states of americabacon-lettuce-tomato sandwichsir sarvepalli radhakrishnannational institutes of healthright atrioventricular valvebrassica oleracea gongylodespolicing and enforcement costalternanthera philoxeroidescorrectional rehabilitationhunting and gathering societylassen volcanic national parkwar of the austrian successiondorothy mary crowfoot hodgkinanton grigorevich rubinsteinmalignant neoplastic diseaseadrenocorticotropic hormonepersonal information managercapital of trinidad and tobagojames abbott mcneill whistlerhuman immunodeficiency virussecretary of veterans affairssubmandibular salivary glandstandard anatomical positionherpes varicella zoster virusdepartment of transportationemployee stock ownership planunited arab emirates's capitalsir charles scott sherringtonstanding operating procedure
...View all with 26 letters...
Words (2)
electroencephalographicallyethylenediaminetetraacetatePhrases (177)
business environment analysispartial differential equationamerican revolutionary leadernikita sergeyevich khrushchevholy roman emperor frederick iigeorge percy aldridge graingeraleksandr sergeyevich pushkinelectromechanical transduceroffice of management and budgetsolenostemon scutellarioidesnational labor relations boardaugustus welby northmore pugindirector-stockholder relationtransmission control protocolfreedom from search and seizureco-operative republic of guyanabeta-adrenergic blocking agentcommissioned military officerelectronic musical instrumentnuclear regulatory commissionjerusalem artichoke sunflowertriticum dicoccum dicoccoidesadrenocorticotrophic hormonedeoxyadenosine monophosphatesocial development commissiontricyclic antidepressant drugdeoxythymidine monophosphateinternational court of justicejames augustine aloysius joycepositive reinforcing stimulusthyrotropin-releasing hormonecryptobranchus alleganiensistaras grigoryevich shevchenkoprincipality of liechtensteinhomo sapiens neanderthalensis
...View all with 27 letters...
Words (1)
ethylenediaminetetraacetatesPhrases (158)
revolutionary people's struggleinterstate commerce commissionaleksandr feodorovich kerenskybusiness process reengineeringbureau of engraving and printingephippiorhynchus senegalensistriphosphopyridine nucleotideoxytetracycline hydrochloridemarcus junius brutus the youngerstrategic arms limitation talksgallinula chloropus cachinnansfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskydistinguishing characteristiccardiopulmonary resuscitationmicrosoft disk operating systemcommission on the status of womenbattles of lexington and concordthird council of constantinoplecapital of serbia and montenegrocucurbita maxima turbaniformisjohan julius christian sibeliusdemocratic republic of the congoraphanus sativus longipinnatuscriminal investigation commandfederal housing administrationfeodor mikhailovich dostoevskifeodor mikhailovich dostoevskyludwig josef johan wittgensteindepartment of homeland securitygrace ethel cecile rosalie allenmaster of arts in library sciencevladimir vladimirovich nabokovsuperconducting supercollidersergei mikhailovich eisenstein
...View all with 28 letters...
Words (2)
methylenedioxymethamphetaminehexakosioihexekontahexaphobiaPhrases (113)
business environmental analysisbusiness interruption insurancesecond council of constantinoplealeksandr nikolayevich scriabinchemical decomposition reactionacrylonitrile-butadiene-styreneantisocial personality disordermale internal reproductive organfriedrich wilhelm august froebelnational volunteers associationdisorganized type schizophreniadmitri dmitrievich shostakovichautomatic data processing systemcombination in restraint of tradecapital of the dominican republicsouth-central dravidian languagegiovanni pierluigi da palestrinacapital of the russian federationsao thome e principe monetary unitscrutin uninominal voting systeminternational olympic committeemiddle east respiratory syndromeferdinand joseph la menthe mortonunited arab emirate monetary unitbaron de la brede et de montesquieucongregational christian churchdisseminated multiple sclerosisreceived pronunciation languagekatmai national park and preservehydrangea macrophylla hortensisconstitution of the united statestheodore roosevelt national parkautoclaved lightweight concretelydia kamekeha paki liliuokalanipresident william henry harrison
...View all with 29 letters...
Words (1)
chlorobenzylidenemalononitrilePhrases (84)
battle of spotsylvania court housebattle of spotsylvania courthousevalentina vladmirovna tereshkovamusculus sternocleidomastoideusreduced instruction set computingalexander isayevich solzhenitsynglutamic oxalacetic transaminaseobsessive-compulsive personalityself-report personality inventorybachelor of arts in library sciencedepartment of energy intelligencedouble standard of sexual behaviorcoluber constrictor flaviventrisjacques anatole francois thibaultdepository financial institutionvicomte ferdinand marie de lessepsethylenediaminetetraacetic acidrepublic of bosnia and herzegovinaaleksandr mikjailovich prokhorovuniversal gravitational constantbalance of international paymentsmultiple correlation coefficientaugust friedrich leopold weismannwaterhouse-friderichsen syndromesevere acute respiratory syndromesevere combined immunodeficiencyalessandro di mariano dei filipepipolymonium caeruleum van-bruntiaehyperbilirubinemia of the newborncalymmatobacterium granulomatismusculus transversalis abdominiscalifornia personality inventoryfield-sequential color televisioncomplex instruction set computingplasma thromboplastin antecedent
...View all with 30 letters...
Words (1)
dichlorodiphenyltrichloroethanePhrases (81)
united states public health servicegreat smoky mountains national parkbureau of intelligence and researchsecond epistle to the thessaloniansfreedom from involuntary servitudemarie louise elisabeth vigee-lebrundigital communications technology2019-ncov acute respiratory diseasepetroselinum crispum neapolitanumguiseppe fortunino francesco verdiunited states department of defensetupac amaru revolutionary movementsidonie-gabrielle claudine colettesir john frederick william herschelunited states trade representativefrances elizabeth caroline willardrevolutionary proletarian nucleusdiego rodriguez de silva y velazquezchickasaw national recreation areaposterior vein of the left ventriclepalestine liberation organizationmanipulative electronic deceptioninterstitial plasma cell pneumoniapalestinian popular struggle frontanicius manlius severinus boethiuselectromotive drug administrationprimary subtractive color for lightislamic great eastern raiders-frontgeorges eugene benjamin clemenceauislamic jihad movement in palestinemaxwell-boltzmann distribution lawfemale internal reproductive organrank-order correlation coefficientoscar fingal o'flahertie wills wildelanius ludovicianus excubitorides
...View all with 31 letters...
Words (1)
tetrabromo-phenolsulfonephthaleinPhrases (52)
nikolai andreyevich rimski-korsakovafrican american vernacular englishpeople against gangsterism and drugspatent and trademark office databasehierarchical classification systemweakly interacting massive particlesergei aleksandrovich koussevitzkyintercontinental ballistic missilestraight-line method of depreciationrevolutionary justice organizationobject-oriented programing languagecount nikolaus ludwig von zinzendorfnikolai andreyevich rimsky-korsakovcercopithecus aethiops pygerythrussodium ethylmercurithiosalicylatenonsteroidal anti-inflammatory drugisidore auguste marie francois comteuniversity of california at berkeleymarcus aurelius valerius maximianusprimary subtractive colour for lightnational liberation front of corsicatheory of electrolytic dissociationketosis-resistant diabetes mellitusinsulin-dependent diabetes mellituscockcroft-walton voltage multiplierroberto francesco romolo bellarmineelectronic counter-countermeasuresabu ali al-husain ibn abdallah ibn sinaedmond louis antoine huot de goncourtlymphocytic choriomeningitis virusyevgeni aleksandrovich yevtushenkowilhelm apollinaris de kostrowitzkiindependent state of papua new guineatyrannus domenicensis domenicensisprogressive emphysematous necrosis
...View all with 32 letters...
Phrases (48)
characteristic root of a square matrixlinear-quadratic-gaussian controllermusical instrument digital interfaceautonomous sensory meridian responsebreach of trust with fraudulent intentinternational maritime organizationstandard generalized markup languageepistle of paul the apostle to philemoncongress of industrial organizationslycopersicon esculentum cerasiformeobject-oriented programming languagemusculus abductor digiti minimi manusmusculus abductor digiti minimi pedisbureau of alcohol tobacco and firearmsorganization of the oppressed on earthmusculus obliquus externus abdominispityrogramma calomelanos aureoflavaelizabeth cleghorn stevenson gaskellnondepository financial institutionprivilege against self incriminationmusculus sphincter ductus choledochilaser-assisted in situ keratomileusisgeneral agreement on tariffs and tradesir winston leonard spenser churchillright to speedy and public trial by juryfinancial crimes enforcement networkkonstantin sergeyevich stanislavskydisease of the neuromuscular junctionmercury-in-glass clinical thermometerfloating-point representation systemsecretary of health and human serviceshighly active antiretroviral therapyeconomic commission for latin americainternational law enforcement agencycapital: critique of political economy
...View all with 33 letters...
Phrases (40)
jacques francois fromental elie halevyrelational database management systemconfidential adviser-advisee relationchronic obstructive pulmonary diseasefederal islamic republic of the comorosfederal national mortgage associationacademy of television arts and sciencesepistle of paul the apostle to the romansgeorge louis palmella busson du mauriernero claudius caesar drusus germanicuscosmic microwave background radiationinterstitial cell-stimulating hormonemusculus sphincter ductus pancreaticifriedrich august kekule von stradonitzeuropean law enforcement organisationvena centralis glandulae suprarenalisfunctional magnetic resonance imaginghermann ludwig ferdinand von helmholtzdryopithecus rudapithecus hungaricusclostridium perfringens epsilon toxinfour-stroke internal-combustion engineprince otto eduard leopold von bismarckmassachusetts institute of technologyfederal deposit insurance corporationeconomic and social council commissionfederal home loan mortgage corporationdepartment of health and human servicesassociation of southeast asian nationstiberius claudius nero caesar augustusforeign intelligence surveillance actbaron hugh caswall tremenheere dowdingeinstein's general theory of relativityeinstein's special theory of relativitymovimiento revolucionario tupac anaruunited states fish and wildlife service
...View all with 34 letters...
Phrases (32)
national baseball hall of fame and museumnational technical information servicejohann christoph friedrich von schillercommunications security establishmentinternational development associationunited states postal inspection servicetadeusz andrzej bonawentura kosciuszkorevolutionary organization 17 novemberrevolutionary people's liberation frontrevolutionary people's liberation partycomte donatien alphonse francois de sadecanadian security intelligence serviceimmaculate conception of the virgin marymaxmillien marie isidore de robespierrehereditary motor and sensory neuropathycockcroft and walton voltage multipliernational socialist german workers' partychristopher william bradshaw isherwoodimmigration and naturalization serviceanti-imperialist international brigadequintus septimius florens tertullianusfederal democratic republic of ethiopiatransurethral resection of the prostatefederal law enforcement training centerballistic missile defense organizationnon-insulin-dependent diabetes mellitussubacute sclerosing leukoencephalitisselective-serotonin reuptake inhibitorfraxinus pennsylvanica subintegerrimasecurity intelligence review committeeproduct-moment correlation coefficientunited states naval research laboratoryPhrases (26)
center for disease control and preventionrank-difference correlation coefficientjakob ludwig felix mendelssohn-bartholdyangiotensin-converting enzyme inhibitorforeign intelligence surveillance courtchurch of jesus christ of latter-day saintsnational geospatial-intelligence agencyjuan carlos victor maria de borbon y borbonfield-sequential color television systemfreedom from cruel and unusual punishmenttripleurospermum oreades tchihatchewiialbert francis charles augustus emmanueltransportation security administrationinternational association of lions clubssecretary of health education and welfarecriminal intelligence services of canadaalbrecht eusebius wenzel von wallensteinnatural language processing applicationtiberius claudius drusus nero germanicussocialist people's libyan arab jamahiriyavenae dorsales clitoridis superficialesbaron karl maria friedrich ernst von weberdeclining balance method of depreciationpublius cornelius scipio africanus majornaval air warfare center weapons divisionunited states government printing officePhrases (26)
severe combined immunodeficiency diseasesisters of the order of saint basil the greatfirst epistle of paul the apostle to timothyunited states declaration of independenceal-jama'a al-islamiyyah al-muqatilah bi-libyatheodore roosevelt memorial national parkketoacidosis-resistant diabetes mellitusuniversity of north carolina at chapel hillattention deficit hyperactivity disordercentre for international crime preventiondemocratic and popular republic of algeriagenerally accepted accounting principlesdemocratic socialist republic of sri lankatrivalent live oral poliomyelitis vaccinesecretary of housing and urban developmentu.s. army criminal investigation laboratoryacademy of motion picture arts and sciencesdepartment of health education and welfarekarl friedrich hieronymus von munchhausenepistle of paul the apostle to the ephesiansepistle of paul the apostle to the galatiansus army criminal investigation laboratorycongregation of the sisters of saint hedwigsixteen personality factor questionnairesupreme headquarters allied powers europeunited states national library of medicinePhrases (13)
general certificate of secondary educationunited states government accounting officeobject-oriented database management systemsecond epistle of paul the apostle to timothyalexis charles henri maurice de tocquevilledemocratic republic of sao tome and principeinternational civil aviation organizationeconomic commission for asia and the far eastmarie joseph paul yves roch gilbert du motierdepartment of housing and urban developmentadvanced research and development activityepistle of paul the apostle to the colossiansminimally invasive coronary bypass surgeryPhrases (14)
million floating point operations per secondbillion floating point operations per secondrussian soviet federated socialist republicdefense reutilization and marketing serviceislamic jihad for the liberation of palestinedirectorate for inter-services intelligencerespiratory distress syndrome of the newborngates of the arctic national park and preservenucleoside reverse transcriptase inhibitorpopular front for the liberation of palestinefuerzas armadas revolucionarios de colombiabaron hermann ludwig ferdinand von helmholtzepistle of paul the apostle to the philippiansenzyme-linked-immunosorbent serologic assayPhrases (13)
nicotinamide adenine dinucleotide phosphateassociation of islamic groups and communitiesminnesota multiphasic personality inventoryrevolutionary proletarian initiative nucleinational archives and records administrationprayer of azariah and song of the three childrenlaser-assisted subepithelial keratomileusisregents of the university of california v. bakkerussian soviet federative socialist republicinternational relations and security networkursulines of mary immaculate virgin of gandinofirst of october antifascist resistance grouptrillion floating point operations per secondPhrases (7)
pearson product-moment correlation coefficientarmy high performance computing research centerpaul ludwig von beneckendorff und von hindenburgbasal body temperature method of family planningdemocratic front for the liberation of palestinenon-nucleoside reverse transcriptase inhibitorbaron friedrich heinrich alexander von humboldtPhrases (9)
revolutionary organization of socialist muslimsnational oceanic and atmospheric administrationtransmission control protocol/internet protocolcooper union for the advancement of science and artfifth amendment to the united states constitutionfirst amendment to the united states constitutionarmenian secret army for the liberation of armeniamedical literature analysis and retrieval systeminternational society for krishna consciousnessPhrases (7)
abul-walid mohammed ibn-ahmad ibn-mohammed ibn-roshdassociation for the advancement of retired personsprayer of azariah and song of the three holy childrengeorges leopold chretien frederic dagobert cuvierconte alessandro giuseppe antonio anastasio voltafirst epistle of paul the apostle to the corinthiansunited states army criminal investigation commandPhrases (8)
international bank for reconstruction and developmentnineteenth amendment to the united states constitutionfourteenth amendment to the united states constitutionfood and agriculture organization of the united nationseighteenth amendment to the united states constitutionunited nations international children's emergency fundroyal society of london for improving natural knowledgeunited society of believers in christ's second appearing