Definitions
There is 1 meaning of the phrase
Genetic Disorder.
Genetic Disorder - as a noun
A disease or disorder that is inherited genetically
Synonyms (Exact Relations)
congenital diseasegenetic abnormalitygenetic defectgenetic diseasehereditary conditionhereditary diseaseinherited diseaseinherited disorderHypernyms (Closely Related)
disease8Hyponyms (Broadly Related)
monogenic diseasemonogenic disorderpolygenic diseasepolygenic disorder
Load more...
achondroplasia22achondroplastychondrodystrophyosteosclerosis congenitaabetalipoproteinemiainborn error of metabolismcongenital megacolonhirschsprung's diseasemucopolysaccharidosishyperbetalipoproteinemiaichthyosis21branched chain ketoaciduriamaple syrup urine diseasemcardle's diseasedystrophy21muscular dystrophyoligodactylyoligodontiaotosclerosis14autosomal dominant diseaseautosomal dominant disorderautosomal recessive defectautosomal recessive diseasecongenital pancytopeniafanconi's anaemiafanconi's anemiajuvenile amaurotic idiocyspielmeyer-vogt diseasecongenital afibrinogenemiaalbers-schonberg diseasemarble bones diseaseosteopetrosis15nevoid elephantiasispachydermadwarfism17nanism8lactase deficiencylactose intolerancemilk intoleranceporphyria19hepatolenticular degenerationwilson's disease
Load more...
Example Sentences
"Cystic fibrosis is a common genetic disorder that affects the lungs and digestive system."
"Down syndrome is a genetic disorder caused by the presence of an extra chromosome."
"Huntington's disease is a degenerative genetic disorder that affects the nervous system."
"Sickle cell anemia is a genetic disorder characterized by unusually shaped red blood cells."
"Phenylketonuria (PKU) is a genetic disorder that prevents the body from properly breaking down an amino acid called phenylalanine."