Words Containing: R,I,C,K,E,Y,_
(In Any Order)
There are 69 words,
240 phrases and
0 abbr's with
R,I,C,K,E,Y,_ in.
Best Scoring Words With: R,I,C,K,E,Y,_
More words | |||||||
---|---|---|---|---|---|---|---|
Rank | Word | Save? | Length | Usage | Points | Type | |
1 | hystericky | 10 | 25 | ||||
2 | dickeybird | 10 | 23 | nounn | |||
3 | kerygmatic | 10 | 22 | adjectiveadj | |||
4 | cherrylike | 10 | 22 | adjectiveadj | |||
5 | bricklayer | 10 | 21 | nounn | |||
6 | pernickety | 10 | 21 | adjectiveadj | |||
7 | flickery | 8 | 20 | adjectiveadj | |||
8 | creakingly | 10 | 20 | adverb, adjectiveadv, adj | |||
9 | eukaryotic | 10 | 19 | adjectiveadj | |||
10 | strickenly | 10 | 19 | ||||
or scroll down to see all results... | |||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (12)
hyperkinetic26flickeringly25karyokinetic25hydrokinetic25skyrocketing26fairnytickle24blackish-greygreyish-blackfernytickles24hydraulicked26locksmithery26quicksilvery33Phrases (9)
patrick henrycylinder lockvery much likeslippery dickmercy killingreality checkbirthday cakewater hickoryliterary hackWords (9)
blackberrying27fairnytickles25kitty-corneredhydrokinetics26knickknackeryprickly-leafedprickly-leavedkeratomycosispsychometrikaPhrases (12)
bitter hickoryrichard leakeycylinder blocknutmeg hickorykinetic energykinetic theorycheckered lilybrake cylindercycle rickshawice-hockey rink
...View all with 13 letters...
Words (7)
hyperkeratotic28heterokaryotic26megakaryocytic31hydrokinetical27blackberry-lilyblackberryings28huckleberrying29Phrases (15)
kyrgyz republicdynamic speakerstanley kubrickrockrose familydesk dictionaryhydraulic brakefriedrich hayekhenry clay frickrichard starkeysticky geranium
...View all with 14 letters...
Phrases (1)
technical analysis of stock trendsPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay