Words Containing: R,I,C,K,E,Y
(In Any Order)
There are 69 words,
240 phrases and
0 abbr's with
R,I,C,K,E,Y in.
Best Scoring Words With: R,I,C,K,E,Y
More words | |||||||
---|---|---|---|---|---|---|---|
Rank | Word | Save? | Length | Usage | Points | Type | |
1 | crickey | 7 | 18 | ||||
2 | pickery | 7 | 18 | verb, nounv, n | |||
3 | rickety | 7 | 16 | adjectiveadj | |||
4 | yuckier | 7 | 16 | adverb, adjectiveadv, adj | |||
5 | rickeys | 7 | 16 | nounn | |||
6 | yickers | 7 | 16 | ||||
7 | rickey | 6 | 15 | verb, nounv, n | |||
8 | yicker | 6 | 15 | ||||
or scroll down to see all results... | |||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (9)
persnickety22bricklayers22gimcrackery25factorylike23lickerishly23kitty-cornerrheumaticky25dickeybirds24fernytickle23Phrases (16)
policy makercelery stickbicycle rackchicken yardparity checknew york cityhickory pinehickory treecorn whiskeycrystal mikesticky astersilky cornelcity slickerprickly heatprickly pearprickly pineWords (12)
hyperkinetic26flickeringly25karyokinetic25hydrokinetic25skyrocketing26fairnytickle24blackish-greygreyish-blackfernytickles24hydraulicked26locksmithery26quicksilvery33Phrases (9)
patrick henrycylinder lockvery much likeslippery dickmercy killingreality checkbirthday cakewater hickoryliterary hackWords (9)
blackberrying27fairnytickles25kitty-corneredhydrokinetics26knickknackeryprickly-leafedprickly-leavedkeratomycosispsychometrikaPhrases (12)
bitter hickoryrichard leakeycylinder blocknutmeg hickorykinetic energykinetic theorycheckered lilybrake cylindercycle rickshawice-hockey rinkdelivery truckhyman rickoverWords (7)
hyperkeratotic28heterokaryotic26megakaryocytic31hydrokinetical27blackberry-lilyblackberryings28huckleberrying29Phrases (15)
kyrgyz republicdynamic speakerstanley kubrickrockrose familydesk dictionaryhydraulic brakefriedrich hayekhenry clay frickrichard starkeysticky geraniummonkey pinscherday of reckoningprickly lettucefrederick soddyhyman g. rickoverWords (3)
phenylketonuric29poverty-strickenhuckleberryings30Phrases (15)
turkey drumstickcapital of turkeysecurity blankethydraulic brakesmaryland chickenfrancis scott keyhuckleberry finnrepublic of kenyaproboscis monkeyhackney carriagepsychedelic rockcarl yastrzemskiyukon white birchsedimentary rockice-hockey playerWords (1)
phenylketonuricsPhrases (17)
strictly speakingcapital of new yorkyellowfin croakersnowy tree cricketmockernut hickorybitternut hickoryshellbark hickorypeter tchaikovskyrepublic of turkeymilitary blockadeblack cypress pinehairy honeysucklecatalytic crackerartificial kidneywhisky on the rockspocket dictionaryprickly-edged leafPhrases (16)
henry louis menckenpresident mckinleysympathetic strikeamerican turkey oakrunning blackberryblackberry liqueurswampy beggar-tickskyphosus sectatrixnickel-iron batterybricklayer's hammercape york peninsulawhite-heart hickoryamerican hackberrywhiskey on the rocksprickly pear cactusprickly shield fernPhrases (19)
kilocycle per secondgrace patricia kellyshirley temple blackvaledictory speakerbicycle parking rackafrican green monkeyruby-crowned kingletmexican black cherrydynamic loudspeakertoxic shock syndromecommodity brokeragehydrokinetic enginepickerelweed familydiversionary attackfamily parkeriaceaeacute kidney failureredbrick universityrocky mountain sheeprocky-mountain maplePhrases (14)
mickey charles mantlekate o'flaherty chopinparticolored buckeyekayser-fleischer ringinsulin shock therapymother carey's chickenkinetic theory of heatfrank breech deliveryalfred charles kinseybig shellbark hickorycalochortus kennedyiprickly custard appleignacy jan paderewskihyman george rickoverPhrases (19)
yellow-shafted flickerpsychopsis kramerianakinetic theory of gasesmacroclemys temminckihyperkinetic syndromefamily rickettsiaceaeprince fumimaro konoyechronic kidney failurerichard erskine leakeykosteletzya virginicalyrurus mlokosiewiczibiscayne national parkwilliam frederick codykrebs citric acid cyclegranulocytic leukemiarocky mountain dogbaneprickly-seeded spinachrocky mountains cherrytartarian honeysucklePhrases (12)
pearl sydenstricker buckhydraulic brake cylindergroundbreaking ceremonyboris vasilevich spasskyarcuate vein of the kidneymourning cloak butterflychesapeake bay retrieveramerican fly honeysucklemediterranean hackberryyellow-bellied sapsuckerrocky mountain whitefishmortgage-backed securityPhrases (12)
dorothy rothschild parkeryuri alekseyevich gagarinbryce canyon national parkfriedrich august von hayekislamic party of turkestantheory of weak interactionwernicke's encephalopathywilliam bradford shockleytrofim denisovich lysenkocyril northcote parkinsonsir frederick handley pagecheyne-stokes respirationPhrases (1)
technical analysis of stock trendsPhrases (1)
konstantin sergeyevich stanislavskyPhrases (1)
national socialist german workers' partyPhrases (1)
karl friedrich hieronymus von munchhausenPhrases (1)
enzyme-linked-immunosorbent serologic assay