Words Containing: K,H,A
(In Any Order)
There are 2,554 words,
1,807 phrases and
3 abbr's with
K,H,A in.
Best Scoring Words With: K,H,A
More words | |||||||
---|---|---|---|---|---|---|---|
Rank | Word | Save? | Length | Usage | Points | Type | |
1 | kajawah | 7 | 24 | ||||
2 | hijacks | 7 | 23 | verb, nounv, n | |||
3 | khazens | 7 | 23 | nounn | |||
4 | hijack | 6 | 22 | verb, nounv, n | |||
5 | khazen | 6 | 22 | nounn | |||
6 | khazis | 6 | 22 | ||||
7 | khodjas | 7 | 22 | ||||
8 | whacky | 6 | 21 | adjectiveadj | |||
9 | haycock | 7 | 21 | nounn | |||
10 | chachka | 7 | 21 | nounn | |||
or scroll down to see all results... | |||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (170)
thanks13shaken13hacker15hijack22kahuna13chakra15shaker13whacko18mohawk18kazakhkhalsashrank13harken13hawker16hankie13shaktigurkhakhalif16kasbah15thwack18whacky21chalky18khakis17hackie15hanker13pashka15rakish13shiksa13hakeem15kahluakwacha18hawkey19chukka19mikvah18kathak17
...View all with 6 letters...
Phrases (1)
hack onWords (265)
shaking15krishnashankarwhacked20lakshmihacking17hawkinshawking18kashmir16hammock20karachihancockrebekahshackle16hacksaw19shakers14hatrack16hackney19kaddish16backhoe18whacker19hackman18eckharthaddock18shakily17hanukahchampak20shakeup16kachina16haycock21thankee14klamathkharkovmawkish19knavish17
...View all with 7 letters...
Phrases (14)
tax hikehot cakehen hawkwar hawkham hockchalk upash cakehack sawpak choimake hayhawk owlsilk hatshack upholm oakWords (382)
thankful18paycheck24oklahomarickshaw20hokkaidoskinhead16haystack20whacking21yokohamahandbook18hallmark17pachinko19hijacker24backhand20bulkhead18kandaharshackled18archduke18hanukkahkalaharishakiest15backache21freakish18humpback23shoptalk17backlash19chanukahtomahawk20chickpea21shamrock19headlock18khartoumhezekiahkabbalah19babushka19
...View all with 8 letters...
Phrases (58)
cant hooktalk showblack ashchalk outthank youark shellhold backball hawkreap hooktake a hopbank shotfish cakefish hawkcub sharkhash markheat sinkshake offtank shipmeat hooktom hanksfish tankbrash oakred chalkhat tricktalk shopwage hikecow sharkskew archkeel archcat sharkwatch keyhang backjunk heaphark backbad check
...View all with 8 letters...
Words (463)
cockroach22sheldrake17handshake20skinheads17birthmark20checkmate22horseback20hijacking26humankind19flashback23hunchback25blockhead21handiwork20milkshake22shoemaker18makeshift21akhenatenartichoke18thankless16throwback23handbrake19buckwheat23shakedown20homemaker20landshark17matchbook22ashkenazinighthawk23kathmandumarrakeshhankering17shortcake18lakeshore16snakehead17marrakech
...View all with 9 letters...
Phrases (95)
louis kahntank shelldisk shapethink backcock-a-hoopsketch maprain checkchoke backchalk talkhave a lookfight backant shrikephone jackrock hyraxsay hey kidmake happykarl barthback toothmilk shakebench markthomas kyddark horsenorth peakloan sharkcard sharkbaking hotlake huronlook sharpdisk cachethrow backmeat hooksfish steaklake tahoemarch kingwhite cake
...View all with 9 letters...
Words (413)
earthquake26blacksmith23heartbreak19thankfully23cheesecake21kazakhstancheapskate21workaholic22matchmaker23jackhammer30steakhouse17watchmaker24paddywhack29chalkboard22heatstroke17aftershock22freakishly23crankshaft22matchstick23mackintosh21blackthorn21unshakable19shirtmaker19hammerlock23housebreak19switchback26backhanded23humpbacked26unthankful20ramshackle21sheepshank22threadlike18khitmutgar20unshakably22blackheart21
...View all with 10 letters...
Phrases (114)
off-the-rackhard workercharm quarkknut hamsunstrike hardgenus khayashish kebabphrase bookpigeon hawkjohnny cakeherman woukjakob bohmeout of whacksneak thiefblack deathhook and eyerake handleblank shelltake hold ofcatch a winktake the airtack hammerbaked blushhard knocksblack whaletaking holdnurse sharkkunlan shanshake handsdisk harrowshumard oakhead gasketsilver hakehockey gamewhale shark
...View all with 10 letters...
Words (325)
shakespeareheartbroken20hardworking23unthinkable20knucklehead25hypermarket25tchaikovskytutankhamunmatchmaking25kalashnikov25workmanship25baryshnikovtutankhamenunshakeable20handshaking23speechmaker24nightwalker22backstretch24hunchbacked28kindhearted20hypokalemia25weathercock25hypokalemic27apparatchik24leatherneck20deutschmarkchucklehead26blockheaded24thickheaded25mawkishness23chockablock30kinesthesia18phrasemaker22backbencher26chickamauga
...View all with 11 letters...
Phrases (147)
tribal sheikcrank handlehockey coachchock-a-blockdasht-e-kavirbluish blackshell jackettalking headpatch pocketalkyl halideturkish bathfrank harrislock chamberjohan kepleranton chekovthird sackerhooded cloakblack cohoshbank charterhealth checkravi shankardanish kronetake a breathtake a chancebook of nahumkarl scheelebroken heartazimuth markjohn hancocktake the cakewhiskey neatstretch marktake-home paypocket watchbox white oak
...View all with 11 letters...
Words (204)
thanksgiving24handkerchief28breakthrough25breathtaking22heartbreaker21thessalonikispeakerphone23marksmanship25speechmaking26shostakovichczechoslovaksaskatchewanhyperkalemiapackinghouse24thankfulness22checkerboard26headshrinker23swashbuckler26earthshaking23bushwhacking30backlighting25stakhanovite22housebreaker21holidaymaker25blatherskite21stickhandled23stickhandles22apparatchiki25apparatchiks25hyperkinesia24heterokaryon22workaholisms24blackhanders24benchmarking26bushwhackers29
...View all with 12 letters...
Phrases (152)
tribal sheikhlake michiganmalawi kwachacaptain hicksshaking palsyhockey leaguekitchen rangemosquito hawkshelf bracketernst haeckeljohn van vleckarrester hookmerchant bankhorse blanketblight cankergreek drachmaanton chekhovblack catechua. noam chomskycricket matchhackney coachbook of isaiahbook of joshuacracked wheathawkeye statethomas becketpatrick henrypatrick whitehappy-go-luckyhosni mubarakpack togethertack togetherbushel basketday of the weekkahlil gibran
...View all with 12 letters...
Words (128)
heartbreaking23laughingstock24shakespeareanbackscratcher28brokenhearted23phytoplankton27leatherjacket29swashbuckling28kaffeeklatsch32housebreaking23radhakrishnanchameleonlike24shakespearianbrinksmanship26holidaymakers26spaghettilike23knuckleheaded28headshrinkers24handkerchiefs29blacksmithing27swashbucklers27housebreakers22phytoplankter27jackhammering34breakthroughs26thanklessness20thanksgivings25stickhandlers23stickhandling24hyperkinesias25heterokaryons23blatherskites22marksmanships26hydrocracking29brinkmanships26
...View all with 13 letters...
Phrases (155)
el iskandriyahjohn mccormackwhite backlashtomato ketchupjekyll and hydezambian kwachachicken manurechristmas caketelephone jackhatchback doorblack-and-whitekong the mastershock absorberthank offeringhigh-water markdorothy parkerthree kings' dayclothes basketjaroslav hasekbuckwheat cakescotch pancakekhmer languagerichard leakeychesapeake bayknight templarthomas a becketabraham stokerfrench pancakebook of obadiahkarl von frischjack the ripperwater shamrockbackhand driveride horsebackknow what's what
...View all with 13 letters...
Words (56)
czechoslovakiastraightjacket31chickenhearted29unthankfulness24unthinkability26omphaloskepsis27hyperkeratotic28blacksmithings28omphaloskepses27housebreakings24phytoplankters28laughingstocks25thankfulnesses24breathtakingly27brackishnesses25hyperkeratoses26hyperkeratosis26earthshakingly28prankishnesses23heterokaryoses24heterokaryosis24heterokaryotic26thrombokinases25brinksmanships27handkerchieves30keratinophilic25halterbreaking24phytoplanktons28freakishnesses24spokesmanships27phosphokinases28hydrocrackings30backscratchers29backscratching30hydrokinetical27
...View all with 14 letters...
Phrases (162)
weather outlookanthony van dyckanthony vandykesir joseph bankskitchen cabinetblackberry bushmikhail bakuninstephen hawkingaround-the-clockstephen leacockkazakh languagechicken scratchkechua languagehong kong dollararthur koestlerturkish capitalpatchwork quiltblackwall hitchsouth korean wonkhabarovsk kraimeister eckhartjohannes keplerhans adolf krebshorseback ridershark repellentholding paddockbank withdrawalbook of habakkukpacific hemlockcharles dickenskenneth grahameresearch workerbrokerage housealcoholic drinkshrimp cocktail
...View all with 14 letters...
Words (42)
czechoslovakianheartbreakingly28kindheartedness24kinesthetically27kaffeeklatsches34thanklessnesses22straightjackets32pharmacokinetic30microearthquake35phytoplanktonic31thinkablenesses24phenylketonuria27heartsicknesses24thankworthiness28brokenheartedly28backscratchings31chicken-breastedkind-heartednessthickheadedness29blockheadedness28lymphoblast-likeepikeratophakiaspanish-speakingenglish-speakingpinkish-lavenderheartbrokenness24bletheranskates24unchristianlike24unthinkableness24kinematographer27avalokiteshvaraunshakeableness24kinematographic29sketchabilities26phenakistoscope28
...View all with 15 letters...
Phrases (152)
in all likelihoodnikolai bukharinpinchas zukermansnake in the grasskechuan languagewholesale marketmountain hemlocktragulus kanchilturkish languagehooded sheldrakedag hammarskjoldkhalkha languagegustav kirchhoffbuckthorn familyhorseback ridingalfred hitchcockcommon blackfishhakea leucopteraniels henrik abelruholla khomeinikingdom of bhutanhookworm diseasest. thomas a beckettaras shevchenkosparkplug wrenchhawksbill turtlecornhusker statebasketball coachelectrical shocklogical thinkinghostile takeoveruncompahgre peakjammu and kashmirwilliam shockleyfield hockey ball
...View all with 15 letters...
Words (9)
heterokontophytaunthinkabilitieskinaestheticallypharmacokineticsstraightjacketedphenylketonuriasheterokaryosisesmicroearthquakeskrypterophaneronPhrases (113)
hypophyseal stalkalan lloyd hodgkingeorge walker bushshortbread cookiearam khachaturianalexander pushkindisease of the skinfrank lloyd wrightark of the covenantwest coast hemlockkhirghiz languagecreative thinkingblock anaesthesiamove back and forthjohn hope franklinkashmiri languagecoral honeysuckleknow what's going onkatharine cornelllouis isadore kahnkatherine cornellhelen adams kellerhelen hunt jacksonnikita khrushchevkurdish hezbollahblack-headed snakechemakum languagecooking chocolatekitchen appliancechicken casseroleport jackson heathsonoran whipsnakefrancis hopkinsonelizabeth gaskellhall's honeysuckle
...View all with 16 letters...
Words (7)
triskaidekaphobialeukoencephalitiskindheartednessesstraightjacketingtriskaidekaphobicthreskiornithidaebrokenheartednessPhrases (112)
katsushika hokusaimount kanchenjungakiswahili languagehorned rattlesnakeabkhasian languagecapital of oklahomachinookan languagesackcloth and ashesrudolf karl virchowburning at the stakejaroslav heyrovskyoncorhynchus nerkahook line and sinkersir anthony hopkinscharles f. ketteringbooker t. washingtonmark the evangelistoff the beaten trackjohn maynard keynesdwarf chinkapin oakal-hakim bi-amr allahlouis the wideawakechickasaw languagecharred pancake cupswallow-tailed hawksympathetic strikechicken cacciatorahub-and-spoke systemchicken cacciatoreanaphylactic shockcarolina buckthorncarolina chickadeewhole kit and boodledrinking chocolatenorthern snakehead
...View all with 17 letters...
Words (2)
triskaidekaphobiaspocket-handkerchiefPhrases (88)
dame sybil thorndikebackspace characterkamchatka peninsulaalkaline-earth metalstinking nightshadecalifornia white oakdmitri shostakovichthanksgiving cactuscakchiquel languageanton van leuwenhoekhablot knight brownecyrus hall mccormickkarl friedrich gaussedward lee thorndikeanagasta kuehniellacharles follen mckimbreak someone's heartkarl wilhelm scheelesir frederick ashtonandrew dickson whiteathapaskan languagekatherine mansfieldwilliam shakespearedwarf chinquapin oakhindu kush mountainseurasian kingfisheritalian honeysucklearches national parkherbert clark hooverkalashnikov cultureheat-seeking missilealeksandr pavlovichnikolai lobachevskyaleksandr prokhorovshirley temple black
...View all with 18 letters...
Words (2)
phosphofructokinasemakataimeshekiakiakPhrases (75)
shakespearean sonnethandle with kid glovescapital of kazakhstancalifornia buckthornvalentina tereshkovajapanese honeysucklecapital of north koreacapital of south koreagerard manley hopkinsanton van leeuwenhoekdibranchiate molluskcapital of the ukrainenetwork architecturemickey charles mantlewhite-leaved rockrosemartin luther king daybattle of chickamaugakate o'flaherty chopinkatherine anne porterembryoma of the kidneylepidothamnus fonkiihard-skinned puffballredheaded woodpeckershirodkar's operationkayser-fleischer ringwhole kit and caboodlechocolate chip cookieswamp fly honeysucklecalifornia buckwheatinsulin shock therapylittle-head snakeweedumar al-mukhtar forcessmallmouth black bassarthur edwin kennellyeuropean honeysuckle
...View all with 19 letters...
Words (1)
phosphofructokinasesPhrases (58)
black-capped chickadeeyellow-shafted flickerstephen butler leacockfriedrich alfred krupprepublic of kazakhstanernst heinrich haeckelmechanically skillfulcapital of north dakotahendrik petrus berlagehugo alvar henrik aaltocapital of south dakotaanton pavlovich chekovrocky mountain bighornjohn kenneth galbraithdwarf golden chinkapinpsychopsis kramerianahemlock water dropwortchinese black mushroommetrazol shock therapynerve block anesthesiabluethroat pikeblennymikir-meithei languagesnake's head fritillaryemil klaus julius fuchseuropean house cricketarthur jacob arshawskyhexalectris warnockiihendrik antoon lorentzenglish cocker spanielwilhelm konrad rontgenkinetic theory of gasesharkat-ul-jihad-e-islamiover-the-counter marketwerner karl heisenbergmacrocheira kaempferi
...View all with 20 letters...
Phrases (67)
igor ivanovich sikorskyaleksandr solzhenitsynstephen william hawkingketorolac tromethaminesmallmouthed black bassaram ilich khachaturiankonrad zacharias lorenzanton pavlovich chekhovantonie van leeuwenhoekknight of the round tablecharles frederick worthjohn fitzgerald kennedythomas jonathan jacksonthomas kennerly wolfe jr.william schwenk gilbertschlumbergera buckleyiamerican stock exchangenerve block anaesthesiathin-leaved stringybarkbabe didrikson zahariasketamine hydrochloridewinter crookneck squashskeleton in the cupboardgreater prairie chickenfriedrich august kekuleoriental black mushroomgenus krypterophaneroninsulin shock treatmentpeter ilich tchaikovskytennessee walking horselymphoblastic leukemiawilhelm konrad roentgenharkat-ul-jihad al-islamiking arthur's round tableharley granville-barker
...View all with 21 letters...
Phrases (42)
aleksandr i. solzhenitsynjohn ronald reuel tolkienfrancis richard stocktonbattle of the bismarck searoman osipovich jakobsonjohn davison rockefellerpyotr ilyich tchaikovskyalpha-adrenergic blockerblack-crowned night heroncharlotte perkins gilmanblack-fronted bush shrikehot springs national parksubdivision ginkgophytahydraulic brake cylindermetrazol shock treatmentarchidiskidon imperatormikhail ivanovich glinkaplantation walking horseernestine schumann-heinkeuropean fly honeysuckleboris vasilevich spasskyshenandoah national parkfrank winfield woolworthbuckleya distichophyllaarcuate vein of the kidneyblack english vernacularfirst duke of marlboroughthree-spined sticklebacksaddle block anaesthesiachesapeake bay retrievermatthias jakob schleidenkennelly-heaviside layerbook of the prophet danielthreskiornis aethiopicaamerican fly honeysuckle
...View all with 22 letters...
Phrases (43)
family threskiornithidaetransient ischemic attacknikolai vasilievich gogolkazakhstani monetary unitchristoph willibald glucksarvepalli radhakrishnandorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorwilliam cuthbert faulknerkingdom of the netherlandssir anthony philip hopkinsyuri alekseyevich gagaringeorge herbert walker bushragnar anton kittil frischsir john douglas cockcroftmammoth cave national parkmikhail ivanovich kalininbattle of the caudine forksfriedrich august von hayektheory of weak interactionwernicke's encephalopathybraxton-hicks contractionvirginia katherine mcmathdual inline package switchpink-and-white everlastingwilliam bradford shockleycyril northcote parkinsonhypertext mark-up languagehypertext markup languagephonograph recording diskbecker muscular dystrophysir frederick handley pagenorth korean monetary unitjohn james rickard macleod
...View all with 23 letters...
Phrases (29)
division heterokontophytarichard buckminster fullerbahasa kebangsaan languagecharles john huffam dickensandrei andreyevich gromykohashemite kingdom of jordansubdivision ginkgophytinamaxfield frederick parrishnikolai ivanovich bukharinaleksey maximovich peshkovfrancis henry compton crickbattledore and shuttlecockanatoli yevgenevich karpovjohann joachim winckelmannarcuate artery of the kidneysoutheastern pocket gopherlucy in the sky with diamondsmohandas karamchand gandhihuman t-cell leukemia virus-1domesticated silkworm mothayatollah ruholla khomeinicharles christopher parkerdavid lewelyn wark griffithcharles franklin kettering4.5-inch beach barrage rocketacute lymphocytic leukemianaked as the day you were bornkatharine houghton hepburnkund johan victor rasmussenPhrases (24)
igor fyodorovich stravinskyboris leonidovich pasternakrudolf christian karl dieselsaddam bin hussein at-takritipyotr alexeyevich kropotkincharles frederick menningerandrei arsenevich tarkovskyangus frank johnstone wilsonaleksey maksimovich peshkovmikhail yurievich lermontovsecond marquis of rockinghamchamaecyparis nootkatensiscapital of the united kingdomvon recklinghausen's diseasechronic myelocytic leukemiafederal home loan bank systemhenry kenneth alfred russellcommunist party of kampucheabruckenthalia spiculifoliarashtriya swayamsevak sanghnorth cascades national parkwilliam makepeace thackeraybranched chain ketoaciduriakeratoderma blennorrhagicaPhrases (22)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkx-linked dominant inheritancesir sarvepalli radhakrishnandorothy mary crowfoot hodgkinemployee stock ownership planbooker taliaferro washingtonandrei dimitrievich sakharovmikhail ilarionovich kutuzovchristoph willibald von gluckalexander alexandrovich blokparty of democratic kampucheajohannes diderik van der waalsfirst baron marks of broughtonchronic lymphocytic leukemiasir frederick gowland hopkinsbaron richard von krafft-ebingacute lymphoblastic leukemiabaroness jackson of lodsworthbaroness thatcher of kestevenkathleen mansfield beauchampPhrases (26)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkindirector-stockholder relationjerusalem artichoke sunflowertaras grigoryevich shevchenkosir frederick william herschelrodion romanovich raskolnikovaleksandr aleksandrovich bloknikolai ivanovich lobachevskyaleksandr porfirevich borodinx-linked recessive inheritancemikhail sergeyevich gorbachevkazimir severinovich malevichgeorgi konstantinovich zhukovrudbeckia laciniata hortensiajohannes evangelista purkinjehawai'i volcanoes national parkhawaii volcanoes national parkindustrial workers of the worldmujahidin-e khalq organizationmartin luther king jr's birthdaywilliam iv of the united kingdombaron karl wilhelm von humboldtmaurice hugh frederick wilkinssclerosing leukoencephalitisPhrases (15)
aleksandr feodorovich kerenskyfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskifeodor mikhailovich dostoevskyvladimir vladimirovich nabokovsergei mikhailovich eisensteincount lev nikolayevitch tolstoymikhail aleksandrovich bakuninmildred ella didrikson zahariasgates of the arctic national parkkonstantin sergeevich alekseevfirst earl kitchener of khartoumpatrick victor martindale whitealpha-adrenergic blocking agentWords (1)
hexakosioihexekontahexaphobiaPhrases (10)
aleksandr nikolayevich scriabindmitri dmitrievich shostakovichtheodore roosevelt national parkstephanus johannes paulus krugerlydia kamekeha paki liliuokalanifyodor mikhailovich dostoyevskygrigori aleksandrovich potemkinalfred habdank skarbek korzybskifeodor mikhailovich dostoyevskyvyacheslav mikhailovich molotovPhrases (1)
friedrich august kekule von stradonitz