Words Containing: K,A,E,H
(In Any Order)
There are 1,346 words,
1,420 phrases and
0 abbr's with
K,A,E,H in.
Best Scoring Words With: K,A,E,H
More words | |||||||
---|---|---|---|---|---|---|---|
Rank | Word | Save? | Length | Usage | Points | Type | |
1 | khazens | 7 | 23 | nounn | |||
2 | khazen | 6 | 22 | nounn | |||
3 | whacked | 7 | 20 | verb, adjectivev, adj | |||
4 | hawkeys | 7 | 20 | verbv | |||
5 | hackney | 7 | 19 | noun, adjectiven, adj | |||
6 | whacker | 7 | 19 | nounn | |||
7 | hackery | 7 | 19 | nounn | |||
8 | hawkey | 6 | 19 | noun, adjectiven, adj | |||
9 | chacked | 7 | 19 | verbv | |||
10 | backhoe | 7 | 18 | nounn | |||
or scroll down to see all results... | |||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
hake11Words (44)
shaken13hacker15shaker13harken13hawker16hankie13hackie15hanker13hakeem15hawkey19hackle15shakes13hawked17hanked14kasher13haceks15hacked16pakeha15samekh15keblah15khazen22khedah17khedas14keddah15takahe13hawkie16phreak15hackee15harked14ashake13ashkey16shaked14sheikabekahs15kanehs13
...View all with 6 letters...
Words (81)
whacked20rebekahshackle16shakers14hackney19backhoe18whacker19eckhartshakeup16thankee14hearken14hackery19hauberk16shakier14hotcake16hackles16charked17pakehas16hawkers17chalked17hankers14hankies14harkens14weakish17hackees16hackers16shakoes14hackies16hackled17hackler16hoecake16bethank16hackmen18keblahs16khazens23
...View all with 7 letters...
Phrases (5)
tax hikehot cakehen hawkash cakemake hayWords (154)
paycheck24skinhead16hijacker24bulkhead18shackled18archduke18shakiest15backache21freakish18chickpea21headlock18hezekiahshiitake15deckhand19tashkentlunkhead16latchkey20havelock20tuckahoe17bakeshop19shellack17headwork19hawknose18unshaken15kreplach19herakleshairlike15cakeholekeelhaul15bankheadhatcheck22haymaker20hatmaker17rakehell15hijacked25
...View all with 8 letters...
Phrases (21)
ark shellreap hooktake a hopfish cakeheat sinkshake offmeat hookred chalkwage hikeskew archkeel archwatch keyjunk heapbad checkwhite oaktake a hithawk nosetake heedtake holdeach weeklake chadWords (233)
sheldrake17handshake20skinheads17checkmate22horseback20blockhead21milkshake22shoemaker18makeshift21akhenatenartichoke18thankless16handbrake19buckwheat23shakedown20homemaker20ashkenazimarrakeshhankering17shortcake18lakeshore16snakehead17marrakechchickadee21shrinkage17blackhead21haversack21raincheck20thickhead22headstock19hackamore20thackerayhackneyed22benchmark22earthlike16
...View all with 9 letters...
Phrases (55)
tank shelldisk shapesketch maprain checkchoke backhave a lookant shrikephone jacksay hey kidmake happymilk shakebench markdark horsenorth peaklake hurondisk cachemeat hooksfish steaklake tahoewhite cakeskeen archhoney cakechain pikelike a shotskene archsketch padturk's headcocked hatpark benchchalk lineshock wavejohann eckshoe blackbank checkcheck mark
...View all with 9 letters...
Words (240)
earthquake26heartbreak19cheesecake21cheapskate21matchmaker23jackhammer30steakhouse17watchmaker24heatstroke17aftershock22freakishly23unshakable19shirtmaker19hammerlock23housebreak19backhanded23humpbacked26ramshackle21sheepshank22threadlike18blackheart21checkmated24saltshaker17handbasket20boneshaker19homemaking22reichsmark21shoemaking20unshackled20backhander22cockchafer26wraithlike20rakishness17fatherlike20makeweight23
...View all with 10 letters...
Phrases (76)
off-the-rackhard workerstrike hardgenus khayashish kebabphrase bookpigeon hawkjohnny cakeherman woukjakob bohmesneak thiefblack deathhook and eyerake handleblank shelltake hold oftake the airtack hammerbaked blushblack whalenurse sharkshake handshead gasketsilver hakehockey gamewhale sharkhockey teamwelsh blackjohn walkerlemon sharkgenus hakeatiger sharkhair strokeblack beechshank's mare
...View all with 10 letters...
Words (236)
shakespeareheartbroken20unthinkable20knucklehead25hypermarket25tutankhamenunshakeable20speechmaker24nightwalker22backstretch24hunchbacked28kindhearted20hypokalemia25weathercock25hypokalemic27leatherneck20deutschmarkchucklehead26blockheaded24thickheaded25mawkishness23kinesthesia18phrasemaker22backbencher26kitchenware23steakhouses18bushwhacker28leatherback22shellacking21machinelike22weakhearted22spinachlike22earthquakes27rathskeller18handbaskets21
...View all with 11 letters...
Phrases (105)
tribal sheikcrank handlehockey coachdasht-e-kavirshell jackettalking headpatch pocketalkyl halidelock chamberjohan kepleranton chekovthird sackerhooded cloakbank charterhealth checkdanish kronetake a breathtake a chancekarl scheelebroken hearttake the cakewhiskey neatstretch marktake-home paypocket watchbox white oakquark cheesekiller whalehandies peakhub-and-spokeskeeter hawkchicken farmhockey skatewhale suckerchicken hawk
...View all with 11 letters...
Words (143)
handkerchief28breakthrough25breathtaking22heartbreaker21thessalonikispeakerphone23speechmaking26czechoslovaksaskatchewanhyperkalemiapackinghouse24thankfulness22checkerboard26headshrinker23swashbuckler26earthshaking23stakhanovite22housebreaker21holidaymaker25blatherskite21stickhandled23stickhandles22hyperkinesia24heterokaryon22blackhanders24benchmarking26bushwhackers29leatherbacks23phrasemaking24leathernecks21halterbroken21jackhammered33pathbreaking24kitchenwares24switchbacked29
...View all with 12 letters...
Phrases (108)
tribal sheikhlake michiganhockey leaguekitchen rangeshelf bracketernst haeckeljohn van vleckarrester hookmerchant bankhorse blanketblight cankergreek drachmaanton chekhovblack catechucricket matchhackney coachcracked wheathawkeye statethomas becketpatrick henrypatrick whitepack togethertack togetherbushel basketday of the weekdeutsche markdisk overheadstrike a chordhockey playerathletic sockkitchen matchsnake charmerhockey seasonkurt waldheimhot-water tank
...View all with 12 letters...
Words (95)
heartbreaking23shakespeareanbackscratcher28brokenhearted23leatherjacket29kaffeeklatsch32housebreaking23chameleonlike24shakespearianholidaymakers26spaghettilike23knuckleheaded28headshrinkers24handkerchiefs29swashbucklers27housebreakers22phytoplankter27jackhammering34breakthroughs26thanklessness20stickhandlers23hyperkinesias25heterokaryons23blatherskites22checkerboards27nonshrinkable22backstretches26benchmarkings27speakerphones24phrasemakings25mawkishnesses25hawkishnesses26heartbreakers22gawkishnesses24thinkableness22
...View all with 13 letters...
Phrases (124)
el iskandriyahwhite backlashtomato ketchupjekyll and hydechicken manurechristmas caketelephone jackblack-and-whitekong the mastershock absorberthank offeringhigh-water markdorothy parkerthree kings' dayclothes basketjaroslav hasekbuckwheat cakescotch pancakekhmer languagerichard leakeychesapeake bayknight templarthomas a becketabraham stokerfrench pancakejack the ripperwater shamrockbackhand driveride horsebackcharles wilkeschiang kai-shekcharlie parkersheepskin coathard-cooked eggmigrant shrike
...View all with 13 letters...
Words (46)
czechoslovakiastraightjacket31chickenhearted29unthankfulness24omphaloskepsis27hyperkeratotic28omphaloskepses27housebreakings24phytoplankters28thankfulnesses24breathtakingly27brackishnesses25hyperkeratoses26hyperkeratosis26earthshakingly28prankishnesses23heterokaryoses24heterokaryosis24heterokaryotic26thrombokinases25handkerchieves30keratinophilic25halterbreaking24freakishnesses24spokesmanships27phosphokinases28backscratchers29hydrokinetical27sneakishnesses21shock-absorbentweathercocking29harlequin-snakeleatherjackets30mischief-makingpoikilothermal25
...View all with 14 letters...
Phrases (132)
weather outlookanthony vandykesir joseph bankskitchen cabinetblackberry bushstephen hawkingaround-the-clockstephen leacockkazakh languagechicken scratchkechua languagearthur koestlersouth korean wonmeister eckhartjohannes keplerhans adolf krebshorseback ridershark repellentpacific hemlockcharles dickenskenneth grahameresearch workerbrokerage houseandrei sakharovbasketball hoopmarket researchkalahari desertlake okeechobeekerosene heaterkerosine heaterhydraulic brakechicken and ricefisherman's knotsheet-metal workchinese cork oak
...View all with 14 letters...
Words (39)
czechoslovakianheartbreakingly28kindheartedness24kinesthetically27kaffeeklatsches34thanklessnesses22straightjackets32pharmacokinetic30microearthquake35thinkablenesses24phenylketonuria27heartsicknesses24thankworthiness28brokenheartedly28chicken-breastedkind-heartednessthickheadedness29blockheadedness28lymphoblast-likeepikeratophakiaspanish-speakingenglish-speakingpinkish-lavenderheartbrokenness24bletheranskates24unchristianlike24unthinkableness24kinematographer27avalokiteshvaraunshakeableness24kinematographic29sketchabilities26phenakistoscope28kinesitherapies24keratoacanthoma
...View all with 15 letters...
Phrases (127)
in all likelihoodpinchas zukermansnake in the grasskechuan languagewholesale marketmountain hemlockturkish languagehooded sheldrakekhalkha languagehorseback ridingalfred hitchcockhakea leucopteraniels henrik abelruholla khomeinihookworm diseasest. thomas a beckettaras shevchenkosparkplug wrenchhawksbill turtlecornhusker statebasketball coachelectrical shockhostile takeoveruncompahgre peakwilliam shockleyfield hockey balltadzhik languagealpine milk vetchkurdish languageischaemic strokecanadian hemlockhydraulic brakesrough green snakegreat white sharkmaryland chicken
...View all with 15 letters...
Words (9)
heterokontophytaunthinkabilitieskinaestheticallypharmacokineticsstraightjacketedphenylketonuriasheterokaryosisesmicroearthquakeskrypterophaneronPhrases (98)
hypophyseal stalkgeorge walker bushshortbread cookiealexander pushkindisease of the skinark of the covenantwest coast hemlockkhirghiz languagecreative thinkingblock anaesthesiamove back and forthjohn hope franklinkashmiri languagecoral honeysucklekatharine cornelllouis isadore kahnkatherine cornellhelen adams kellerhelen hunt jacksonnikita khrushchevkurdish hezbollahblack-headed snakechemakum languagecooking chocolatekitchen appliancechicken casseroleport jackson heathsonoran whipsnakeelizabeth gaskellhall's honeysucklemikhail gorbachevamerican white oakswamp chestnut oakphotoplate makingprzevalski's horse
...View all with 16 letters...
Words (7)
triskaidekaphobialeukoencephalitiskindheartednessesstraightjacketingtriskaidekaphobicthreskiornithidaebrokenheartednessPhrases (96)
mount kanchenjungakiswahili languagehorned rattlesnakeabkhasian languagechinookan languagesackcloth and ashesburning at the stakejaroslav heyrovskyoncorhynchus nerkahook line and sinkercharles f. ketteringbooker t. washingtonmark the evangelistoff the beaten trackjohn maynard keyneslouis the wideawakechickasaw languagecharred pancake cupswallow-tailed hawksympathetic strikechicken cacciatorahub-and-spoke systemchicken cacciatorecarolina chickadeewhole kit and boodledrinking chocolatenorthern snakeheadchicken provencalehemorrhagic strokegenus schomburgkiathaddeus kosciuskostinking chamomilegarden huckleberrychicken tetrazzinioriental cockroach
...View all with 17 letters...
Words (2)
triskaidekaphobiaspocket-handkerchiefPhrases (76)
dame sybil thorndikebackspace characterkamchatka peninsulaalkaline-earth metalstinking nightshadecalifornia white oakcakchiquel languageanton van leuwenhoekhablot knight brownekarl friedrich gaussedward lee thorndikeanagasta kuehniellacharles follen mckimbreak someone's heartkarl wilhelm scheelesir frederick ashtonandrew dickson whiteathapaskan languagekatherine mansfieldwilliam shakespeareeurasian kingfisheritalian honeysucklearches national parkherbert clark hooverkalashnikov cultureheat-seeking missilealeksandr pavlovichnikolai lobachevskyaleksandr prokhorovshirley temple blackcalvin richard kleinanointing of the sickgenus kenyapithecustalk through one's hatkamchatkan sea eagle
...View all with 18 letters...
Words (2)
phosphofructokinasemakataimeshekiakiakPhrases (68)
shakespearean sonnethandle with kid glovesvalentina tereshkovajapanese honeysucklecapital of north koreacapital of south koreagerard manley hopkinsanton van leeuwenhoekdibranchiate molluskcapital of the ukrainenetwork architecturemickey charles mantlewhite-leaved rockrosemartin luther king daybattle of chickamaugakate o'flaherty chopinkatherine anne porterembryoma of the kidneylepidothamnus fonkiihard-skinned puffballredheaded woodpeckershirodkar's operationkayser-fleischer ringwhole kit and caboodlechocolate chip cookieswamp fly honeysucklecalifornia buckwheatinsulin shock therapylittle-head snakeweedumar al-mukhtar forcesarthur edwin kennellyeuropean honeysucklecalifornia whipsnakeenglish breakfast tealymphocytic leukemia
...View all with 19 letters...
Words (1)
phosphofructokinasesPhrases (52)
black-capped chickadeeyellow-shafted flickerstephen butler leacockfriedrich alfred krupprepublic of kazakhstanernst heinrich haeckelmechanically skillfulhendrik petrus berlagehugo alvar henrik aaltoanton pavlovich chekovjohn kenneth galbraithdwarf golden chinkapinpsychopsis kramerianahemlock water dropwortchinese black mushroommetrazol shock therapynerve block anesthesiabluethroat pikeblennymikir-meithei languagesnake's head fritillaryemil klaus julius fuchseuropean house crickethexalectris warnockiihendrik antoon lorentzenglish cocker spanielwilhelm konrad rontgenkinetic theory of gasesharkat-ul-jihad-e-islamiover-the-counter marketwerner karl heisenbergmacrocheira kaempferihenry alfred kissingerhistiocytic leukaemiachronic kidney failurecheck overdraft credit
...View all with 20 letters...
Phrases (58)
aleksandr solzhenitsynstephen william hawkingketorolac tromethaminesmallmouthed black basskonrad zacharias lorenzanton pavlovich chekhovantonie van leeuwenhoekknight of the round tablecharles frederick worthjohn fitzgerald kennedythomas kennerly wolfe jr.william schwenk gilbertschlumbergera buckleyiamerican stock exchangenerve block anaesthesiathin-leaved stringybarkbabe didrikson zahariasketamine hydrochloridewinter crookneck squashskeleton in the cupboardgreater prairie chickenfriedrich august kekuleoriental black mushroomgenus krypterophaneroninsulin shock treatmentpeter ilich tchaikovskytennessee walking horselymphoblastic leukemiawilhelm konrad roentgenking arthur's round tableharley granville-barkercasemaking clothes mothforces of umar al-mukhtardaniel patrick moynihangustav robert kirchhoff
...View all with 21 letters...
Phrases (36)
aleksandr i. solzhenitsynjohn ronald reuel tolkienbattle of the bismarck seajohn davison rockefelleralpha-adrenergic blockerblack-crowned night heroncharlotte perkins gilmanblack-fronted bush shrikehydraulic brake cylindermetrazol shock treatmentarchidiskidon imperatorplantation walking horseernestine schumann-heinkeuropean fly honeysuckleboris vasilevich spasskyshenandoah national parkfrank winfield woolworthbuckleya distichophyllaarcuate vein of the kidneyblack english vernacularfirst duke of marlboroughthree-spined sticklebacksaddle block anaesthesiachesapeake bay retrievermatthias jakob schleidenkennelly-heaviside layerbook of the prophet danielthreskiornis aethiopicaamerican fly honeysucklesulphur-crested cockatoomartin heinrich klaproththomas hopkins gallaudetnizhnyaya tunguska rivermediterranean hackberryblack vernacular english
...View all with 22 letters...
Phrases (36)
family threskiornithidaetransient ischemic attacknikolai vasilievich gogolkazakhstani monetary unitsarvepalli radhakrishnandorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorwilliam cuthbert faulknerkingdom of the netherlandsyuri alekseyevich gagaringeorge herbert walker bushmammoth cave national parkbattle of the caudine forksfriedrich august von hayektheory of weak interactionwernicke's encephalopathyvirginia katherine mcmathdual inline package switchpink-and-white everlastingwilliam bradford shockleycyril northcote parkinsonhypertext mark-up languagehypertext markup languagephonograph recording diskbecker muscular dystrophysir frederick handley pagenorth korean monetary unitjohn james rickard macleodnaked as the day one was bornhoratio herbert kitchenercheyne-stokes respirationsluzhba vneshney razvedkikeratosis blennorrhagicatjalling charles koopmans
...View all with 23 letters...
Phrases (26)
division heterokontophytarichard buckminster fullerbahasa kebangsaan languagecharles john huffam dickensandrei andreyevich gromykohashemite kingdom of jordanmaxfield frederick parrishaleksey maximovich peshkovfrancis henry compton crickbattledore and shuttlecockanatoli yevgenevich karpovjohann joachim winckelmannarcuate artery of the kidneysoutheastern pocket gopherlucy in the sky with diamondshuman t-cell leukemia virus-1domesticated silkworm mothayatollah ruholla khomeinicharles christopher parkerdavid lewelyn wark griffithcharles franklin kettering4.5-inch beach barrage rocketacute lymphocytic leukemianaked as the day you were bornkatharine houghton hepburnkund johan victor rasmussenPhrases (23)
boris leonidovich pasternakrudolf christian karl dieselsaddam bin hussein at-takritipyotr alexeyevich kropotkincharles frederick menningerandrei arsenevich tarkovskyangus frank johnstone wilsonaleksey maksimovich peshkovmikhail yurievich lermontovsecond marquis of rockinghamchamaecyparis nootkatensiscapital of the united kingdomvon recklinghausen's diseasechronic myelocytic leukemiafederal home loan bank systemhenry kenneth alfred russellcommunist party of kampucheabruckenthalia spiculifoliarashtriya swayamsevak sanghnorth cascades national parkwilliam makepeace thackeraybranched chain ketoaciduriakeratoderma blennorrhagicaPhrases (18)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkx-linked dominant inheritancesir sarvepalli radhakrishnanemployee stock ownership planbooker taliaferro washingtonandrei dimitrievich sakharovalexander alexandrovich blokparty of democratic kampucheajohannes diderik van der waalschronic lymphocytic leukemiasir frederick gowland hopkinsbaron richard von krafft-ebingacute lymphoblastic leukemiabaroness jackson of lodsworthbaroness thatcher of kestevenkathleen mansfield beauchampPhrases (25)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr sergeyevich pushkindirector-stockholder relationjerusalem artichoke sunflowertaras grigoryevich shevchenkosir frederick william herschelaleksandr aleksandrovich bloknikolai ivanovich lobachevskyaleksandr porfirevich borodinx-linked recessive inheritancemikhail sergeyevich gorbachevkazimir severinovich malevichgeorgi konstantinovich zhukovrudbeckia laciniata hortensiajohannes evangelista purkinjehawai'i volcanoes national parkhawaii volcanoes national parkindustrial workers of the worldmujahidin-e khalq organizationmartin luther king jr's birthdaywilliam iv of the united kingdombaron karl wilhelm von humboldtmaurice hugh frederick wilkinssclerosing leukoencephalitisPhrases (14)
aleksandr feodorovich kerenskyfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskyfeodor mikhailovich dostoevskifeodor mikhailovich dostoevskysergei mikhailovich eisensteincount lev nikolayevitch tolstoymikhail aleksandrovich bakuninmildred ella didrikson zahariasgates of the arctic national parkkonstantin sergeevich alekseevfirst earl kitchener of khartoumpatrick victor martindale whitealpha-adrenergic blocking agentWords (1)
hexakosioihexekontahexaphobiaPhrases (10)
aleksandr nikolayevich scriabindmitri dmitrievich shostakovichtheodore roosevelt national parkstephanus johannes paulus krugerlydia kamekeha paki liliuokalanifyodor mikhailovich dostoyevskygrigori aleksandrovich potemkinalfred habdank skarbek korzybskifeodor mikhailovich dostoyevskyvyacheslav mikhailovich molotovPhrases (1)
friedrich august kekule von stradonitz