PROTEIN Antonyms
There are 9 antonyms of the word
protein.
(opposite meanings)
Also try opposite words for..
proteins
proteins
Best Opposite Words For PROTEIN
| Rank | Word | Save? | Synonyms.. | Usage | Type | |
|---|---|---|---|---|---|---|
| 1 | carbohydrate | nounn | ||||
| 2 | cholesterol | nounn | ||||
| 3 | fiber | nounn | ||||
| 4 | fructose | nounn | ||||
| 5 | glucose | nounn | ||||
| 6 | oil | verb, nounv, n | ||||
| 7 | starch | nounn | ||||
| 8 | sugar | nounn | ||||
| 9 | lipids | nounn |
Alternatives for CARBOHYDRATE
Alternatives for CHOLESTEROL
Alternatives for FIBER
Alternatives for FRUCTOSE
Alternatives for GLUCOSE
Alternatives for OIL
Alternatives for STARCH
Alternatives for SUGAR
Words (42)
candycaramelconfectioneryfructoseglucosehoneyicinglollipopmolassesnectarsaccharinsaccharinesherbetsucrosesugarsweetsweetenersweeteningsyruptreacleboodlebreadcabbagecarbohydrateclamsdinerodoughgeltkalelettucelollylootlucremoolahpelfsaccharidesaccharifyscratchshekelssimoleonssweetenwampumPhrases (1)
refined sugar
