Dictionary Only:
Explicit Words:

15-Letter Words Containing: H,I,G,I

 (In Any Order)
There are 202 15 letter words, 180 15 letter phrases and 0 15 letter abbr's with H,I,G,I in.

Best Scoring 15 Letter Words With: H,I,G,I

RankWordSave?LengthUsagePointsType
1hyperimmunizing15
37 verb, adjectivev, adj
2metaphysicizing15
37 verb, nounv, n
3overemphasizing15
35 verbv
4hyperpolarizing15
35 adjectiveadj
5demythologizing15
35 verb, adjectivev, adj
6remythologizing15
34 verbv
7nephrectomizing15
34
8mathematicizing15
34 verb, adjectivev, adj
9dehydrogenizing15
34 verbv
10hyposensitizing15
33 verb, adjectivev, adj
or scroll down to see all results...
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words.

All 15 Letter Words

Words (202)
notwithstanding23physiologically29cinematographic27psychobiologist28undistinguished21distinguishable22logarithmically26anticholinergic23unchangeability26tightfistedness23biogeographical26bibliographical27unsightlinesses19thunderstriking24theatricalizing30physiographical31overemphasizing35orthogonalizing29misapprehending26inhomogeneities21hyposensitizing33hypervigilances29hyperimmunizing37hydrobiological27historiographic26epithelializing30distinguishably25dishearteningly23disestablishing22disenchantingly25arteriographies21algorithmically26sprightlinesses21silversmithings24semilogarithmic25remythologizing34rehospitalizing30psycholinguists26psychobiologies28preestablishing23photofinishings27photobiologists23photobiological25pathogenicities23overwithholding29oscillographies23orthogonalities19nonbiographical25nephrectomizing34microradiograph26micropublishing27legislatorships21hyperpolarizing35hydrobiologists25homogenizations30homogenisations21histophysiology30histopathologic26heterogeneities19hemoglobinurias23helminthologies24hallucinogenics23graphitizations30extinguishments28electrofishings24ecophysiologies26demythologizing35chronobiologist23chronobiologies23cholinergically26changeabilities23biotechnologist23biotechnologies23biostratigraphy26biogeochemistry28biogeochemicals27bacteriophagies25autobiographies23antishoplifting24oligosaccharide24lexicographical32ideographically27historiographer24exchangeability33whistleblowingszoophysiologist33zoophysiologies33undernourishing20thrillingnesses19thirtysomething27thimbleriggings25theologizations28theologisations19theatricalising21superhumanizing32superhumanising23stratigraphists21stratigraphical23stoichiological23stoicheiologies21stoechiological23stigmatophilist23stigmatophilias23shillyshallying28shillingsworths25seismographical25scrimshandering24scratchbuilding26resynchronizing33resynchronising24remythologising25rehospitalising21psychogeriatric28pseudepigraphic28progenitorships23plagiocephalies25phlogisticating24phenomenalizing32phenomenalising23pachymeningitis28overflourishing25overemphasising26orthogonalising20opisthographies26opisthognathism26oligocythaemias26nothingarianism21nephrectomising25multithreadings22metaphysicizing37metaphysicising28mathematicizing34mathematicising25marconigraphing26magistrateships23lexicographists30kinematographic29ichthyophagists32hyposensitising24hyperpolarising26hyperimmunising28hydrogenization32hydrogenisation23hierogrammatist23hieracosphinges26heresiographies24hepaticologists23hepaticological25helminthologist24haemagglutinins22graphitisations21genethlialogies20ethnolinguistic21epithelialising21enhypostatizing33enhypostatising24distinguishment22dishabilitating22disembellishing24diaphragmatitis24dephlogisticate24demythologising26dehydrogenizing34dehydrogenising25counterweighing25corinthianizing30corinthianising21climatographies25cinemicrography30cineangiography27chargeabilities23cervicographies28cardiographical26biopsychologies28autoschediazing31apothegmatizing33apothegmatising24antiphlogistics23antilogarithmic23aerolithologies19thirty-somethingstraight-grainedspanish-speakingnightmarishness24neighbourliness21mythologization33mythologisation24marginocephalialight-mindednesslife-threateningimperishingnesshippoglossoideshearing-impairedhaemoglobinuria23haemoglobinemiagomphotheriidaegasterophilidaeflemish-speakingenglish-speakingdesynchronizingangiohemophiliaacanthopterygii
Phrases (180)
wishful thinkingwhispering bellsvictor-marie hugougandan shillingthree-ring circusswahili languagesocial gatheringsir john vanbrighshrinking violetsaint ulmo's lightright of electionoliver goldsmithmichel montaignelogical thinkinglight adaptationirrigation ditchhorseback ridinghighly infectivehigher criticismhigh renaissancegeographic pointgenus leishmaniagenus eichhorniagenus delphiniumgenus chinchillafriedrich engelsfiring mechanismethnic cleansingenglish civil warecological nichedispersing phasechange intensitychange integritych'in shih huang tibritish shillingbohemian waxwingwithdrawing roomwill keith kellogwichita languagewhistling marmotwhirling dervishwhirligig beetleweighing machinevisitation rightvaughan williamsthomas higginsonthanksgiving daytelescopic sightteaching readingstarting pitcherstapling machinestamping machinestage technicianspring vetchlingspinning machinesouth frigid zonesolanum wrightiisir john sucklingsign of the zodiacshipping companyshining clubmossshanghai dialectsergei diaghilevsantiago de chilesaint elmo's lightrunning headlineriveting machineright hemispherereporting weightreligious schoolradio brightnesspublishing houseprinting machinepreemptive rightpinus thunbergiione-way light timenorthern whitingnorth frigid zonenizhnyi novgorodnew english biblenavigation lightmen's furnishingsmedicago echinusmartin heideggermalpighian layermalpighia glabramachining centermachine learninglightning hurlerlighting fixturelighting circuitlight microscopelight machine gunlateral thinkingknitting machinekirghiz languagekippered herringkingfisher daisyian douglas smithhypogastric veinhummingbird mothhuldrych zwinglihudsonian godwithousing industryhomogenized milkhodgkin's diseasehighway engineerhigher educationhigh-vitamin diethigh-protein diethigh anglicanismherpes genitalisheraldic bearinghearing examinerhearing disorderhawaiian dancinghanging geraniumhamitic languagehairy darling peaguiana highlandsgraphic designergracilariid mothgolden chinkapingioacchino peccigiant willowherbgenus welwitchiagenus triglochingenus moehringiagenus lysimachiagenus lysichitumgenus lysichitongenus lepechiniagenus hugueniniagenus hippodamiagenus heliophilagenus gleicheniagenus froelichiagenus dolichotisgenus chimaphilagenus callithrixgenus calliophisgenus amphipriongarden symphilidfranking machineforked lightningfor the time beingflight simulatorflight indicatorfinishing schoolfighter aircraftfashion designereuphorbia ingenseuphorbia exiguaenglish springerenglish primroseenglish plantainelectric healingdrive-by shootingdental hygienistdaylight savingscushing's diseasecreeping thistlecreeping charliecreasing machinecombining weightcochimi languagechipping sparrowchinese magnoliachinese angelicacharles ringlingby right of officebrushing machinebreathing devicebolt of lightningauthority figureatlantic herringamerican englishalgorithmic ruleadmission chargeachylia gastrica
WordDB Icon
WordDB
United Kingdom
Download the WordDB app directly on your home screen for instant access. No App Store necessary, less than 1MB storage, always up-to-date and secure.
1.
Tap on share button
2.
Tap on Add To Home Screenadd button
3.
Find WordDB App Icon on your home screen