Words Containing: H,K
(In Any Order)
There are 4,626 words,
2,449 phrases and
10 abbr's with
H,K in.
Best Scoring Words With H,K
More words | |||||||
---|---|---|---|---|---|---|---|
Rank | Word | Save? | Length | Usage | Points | Type | |
1 | kolkhoz | 7 | 27 | nounn | |||
2 | sovkhoz | 7 | 26 | nounn | |||
3 | kolhozy | 7 | 26 | nounn | |||
4 | muzhiks | 7 | 25 | nounn | |||
5 | muzhik | 6 | 24 | nounn | |||
6 | kajawah | 7 | 24 | ||||
7 | hijacks | 7 | 23 | verb, nounv, n | |||
8 | khazens | 7 | 23 | nounn | |||
9 | hijack | 6 | 22 | verb, nounv, n | |||
10 | kvetchy | 7 | 22 | adjectiveadj | |||
or scroll down to see all results... | |||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (317)
thanks13knight14hooked14shrink13hockey18whisky19sketch15cheeky18shaken13sheikh16hiking14choked16hacker15kosher13kimchi17hijack22kahuna13chucky20chunky18chakra15shrunk13chokes15shaker13whacko18mohawk18shucks15hickey18shriek13kazakhshekel13khalsashrank13kyushuunhook13harken13
...View all with 6 letters...
Phrases (5)
hex keyhack onhook onhook uphike upWords (558)
chicken18kitchen16checked19shocked17shaking15whiskey20turkishkrishnachoking17shankarketchup18chuckle18whacked20lakshmihacking17hawkinshooking15schmuck20hawking18shekels14kashmir16thinker14rethink14kurdishhopkinscheckup20hammock20sketchy19shylock19shocker16karachihancockpushkinkeyhole17checker18
...View all with 7 letters...
Phrases (28)
cup hookko punchchock upthink ofthink uphome keyhen hawkchoke upwar hawkham hockchalk upbok choibok choyash cakechirk uphack sawtax hikepak choithe likemusk hogmake hayhawk owlsilk hatshack upholm oakwhisk bydog hookhot cakeWords (754)
thinking16homework20shocking18workshop20thankful18paycheck24oklahomacheckers19sherlock17homesick19rickshaw20helsinkihokkaidoskinhead16whiskers18cherokeebookshop19haystack20skylight19ticklish17chipmunk21checkout19whacking21yokohamahandbook18hallmark17pachinko19hijacker24backhand20kerchief20bulkhead18kandaharshackled18archduke18hanukkah
...View all with 8 letters...
Phrases (94)
cub sharkfire hookhash markheat sinkshake offtank shipmeat hookhot stocktom hanksshun gikufish tankbrash oakjohn rockholy weekcant hookwhole kithuck finnlike hellred chalkthink outhat tricktalk shopwage hiketalk showcow sharkhome folkskew archhong kongjock itchkeel archcat sharkwatch keytuck shophang backjunk heap
...View all with 8 letters...
Words (860)
chuckling21stockholmcockroach22sheldrake17handshake20shrieking17skinheads17hitchcockbirthmark20checkmate22horseback20shrinking17housework19hijacking26humankind19yorkshireshipwreck23flashback23checkbook26hunchback25pinchbeck24blockhead21toothpick20thickness18locksmith20hitchhike24handiwork20milkshake22checkroom22checklist20bookshelf21shoemaker18childlike19makeshift21akhenaten
...View all with 9 letters...
Phrases (160)
lake huronlouis kahnhindu kushlook sharpfish knifedisk cachetank shellthrow backmeat hooksfish steakchurch keyfish stickwhite bookdisk shapedesk phonelake tahoemarch kinghip pocketwhite cakehip socketskeen archhoney cakeslim thickchain pikelike a shotwhole milkskene archthink backjohn spekecock-a-hoopthink overbirch barkthink tanksketch mapsketch out
...View all with 9 letters...
Words (714)
earthquake26blacksmith23chopsticks23checkpoint23heartbreak19thankfully23cheesecake21kazakhstancheapskate21schoolwork22likelihood18shopkeeper21workaholic22matchmaker23bolsheviks22hitchhiker25jackhammer30khrushchevsteakhouse17shockingly23kieselguhr18hitchhiked26knighthood22watchmaker24rethinking18chickenpox30sketchbook25paddywhack29chalkboard22housebroke19heatstroke17aftershock22nightstick20smokehouse19freakishly23
...View all with 10 letters...
Phrases (185)
nurse sharkoff-the-rackkunlan shanchunky heelhard workerdisk clutchshake handshobby knifecharm quarkdisk harrowshumard oakchick sexerknut hamsunhead gasketthrow sticksilver hakerobert kochhockey gameiris kochiistrike hardstrike homehockey puckwhale sharklaugh trackhockey teamchicken legkobus lecheflight deckjohn ruskinchicken outgenus khayathink aboutshish kebabhotel clerkchicken run
...View all with 10 letters...
Words (526)
shakespearehousekeeper20heartbroken20hardworking23unthinkable20knucklehead25hitchhiking27hypermarket25tchaikovskytutankhamunmatchmaking25huckleberry25leeuwenhoekkalashnikov25workmanship25stockholder21honeysuckle23baryshnikovtutankhamenunshakeable20handshaking23speechmaker24nightwalker22neckerchief25backstretch24bucktoothed23kitchenette20housebroken20hunchbacked28shuttlecock22kindhearted20hypokalemia25weathercock25monkeyshine23hypokalemic27
...View all with 11 letters...
Phrases (232)
jinghis khanfield hockeytribal sheikhobble skirtcrank handlemarkov chainkiller whalesoup kitchennoam chomskyhemlock treerobert hookecookie sheethandies peakhub-and-spokehockey coachkitchen helpchicken coopskeeter hawkchicken farmchicken feedhockey skatealan hodgkinwhale suckerwhite cocklechicken hawkhockey stickkitchen sinkchicken kievchock-a-blockthorny skatedasht-e-kavirhome bankingtahoka daisycollet chucksketch block
...View all with 11 letters...
Words (331)
thanksgiving24handkerchief28breakthrough25breathtaking22housekeeping22heartbreaker21electroshock23thessalonikispeakerphone23marksmanship25speechmaking26homesickness23freethinking23shostakovichczechoslovakcockfighting28saskatchewanhyperkalemiapackinghouse24thankfulness22checkerboard26headshrinker23swashbuckler26hyperkinetic26earthshaking23unthinkingly23bushwhacking30backlighting25stakhanovite22unlikelihood20tough-skinnedthanksgivers23quick-sightedflashbacking27stickhandled23
...View all with 12 letters...
Phrases (219)
deutsche marktribal sheikhmarkoff chainlake michiganmalawi kwachalookdown fishdisk overheadcaptain hickscounter checkasthma attacksoupfin sharkstrike a chordchicken brothhockey clinicshaking palsyhockey leaguehockey playerathletic sockkitchen matchockham's razorsnake charmerhockey seasonkurt waldheimkitchen rangenorthern pikehot-water tankkitchen stovekitchen tablebrook thistlehot-work steelwhite croakerchicken liverchicken lousemosquito hawksea of okhotsk
...View all with 12 letters...
Words (189)
heartbreaking23laughingstock24thunderstruck23shakespeareanbackscratcher28brokenhearted23phytoplankton27leatherjacket29swashbuckling28kaffeeklatsch32housebreaking23radhakrishnanchameleonlike24psychokinetic29shakespearianbrinksmanship26psychokinesis27unshrinkingly24haliplanktons22thanksgivings25thankworthily29holidaymakers26stickhandlers23he-huckleberrystickhandling24folkishnesses23chinkerinchee27buttonhooking23cockfightings29weakishnesses23backscratched29electroshocks24backscratches28kletterschuhe25speechmakings27
...View all with 13 letters...
Phrases (227)
el iskandriyahjohn mccormackshipping clerkwhite backlashbitter hickorysheepskin coathard-cooked eggmigrant shrikepush-down stackshumard red oakrobert herrickswallow shrikechickasaw plumchicken breastmetrazol shockyellowish pinkkitchen gardenmocking thrushskeet shootingkitchen islandthrowing stickkitchen middenkitchen policelake whitefishtelephone booktomato ketchupjekyll and hydeketchup bottlezambian kwachachicken littlefuttock shroudmikhail glinkachain pickerelachmad sukarnochaparral cock
...View all with 13 letters...
Words (89)
czechoslovakiastraightjacket31chickenhearted29unthankfulness24unthinkability26schlockmeisterchinkerinchees28backscratchers29backscratching30hydrokinetical27brackishnesses25hyperkeratoses26hyperkeratosis26hyperkeratotic28earthshakingly28trickishnesses23omphaloskepsis27prankishnesses23heterokaryoses24heterokaryosis24counterchecked28heterokaryotic26thrombokinases25sneakishnesses21leukodystrophy30shuttlecocking26checkerberries27huckleberrying29brinksmanships27handkerchieves30blockishnesses25horror-strickenkeratinophilic25poikilothermic27blokeishnesses23
...View all with 14 letters...
Phrases (219)
catharacta skuakalahari desertweather outlooksir john hawkinsanthony hopkinssir john hawkynsanthony van dyckanthony vandykelake okeechobeesir joseph banksdimethyl ketonekerosene heaterkerosine heaterhydraulic brakechicken and riceischemic strokeredhorse suckerkitchen cabinetfisherman's knotsheet-metal workchinese cork oakdogs-tooth checknorthern pin oakblackberry bushmikhail bakuninsympathy strikedogstooth checkstephen hawkingaround-the-clockkitchen utensilnorthern red oakstephen leacockkochia scopariakazakh languagechicken marengo
...View all with 14 letters...
Words (59)
czechoslovakianheartbreakingly28thankworthiness28brokenheartedly28chondroskeleton25backscratchings31counterchecking29chicken-breastedkind-heartednessthickheadedness29blockheadedness28kindheartedness24phenylketonuric29lymphoblast-likehuckleberryings30kinesthetically27kaffeeklatsches34poikilothermousstraightjackets32cholecystokinin29pharmacokinetic30epikeratophakiaspanish-speakingenglish-speakingchildlikenesses25lickerishnesses24microearthquake35phytoplanktonic31pinkish-lavenderheartbrokenness24thinkablenesses24poikilothermies26poikilothermism28phenylketonuria27bletheranskates24
...View all with 15 letters...
Phrases (192)
field hockey ballby hook or by crookanthony comstocktadzhik languagesir john sucklingalpine milk vetchkurdish languagein all likelihoodnikolai bukharinporphyritic rockischaemic strokecanadian hemlockhydraulic brakeschinese checkersrough green snakegreat white sharkkuroshio currentmaryland chickennorthern oak fernpinchas zukermancarolina hemlockretirement checksour mash whiskeysnake in the grasslaughing jackassrough-legged hawkhodgkin's diseasepharaoh's chickenkazimir malevichcommon stinkhornhuckleberry finnpincushion hakeashuttlecock ferntreasurer's checkchicken sandwich
...View all with 15 letters...
Words (16)
heterokontophytaleukodystrophiesunthinkabilitiesthought-provokingkinaestheticallypharmacokineticsstraightjacketedphenylketonuriasphenylketonuricsdneprodzerzhinskdniprodzerzhynskbrownish-speckledheterokaryosisesmicroearthquakescholecystokininskrypterophaneronPhrases (153)
sir john cockcroftnikita khrushchevkurdish hezbollahblack-headed snakethrow out of kilterherbert kitchenerchemakum languagecooking chocolatemockernut hickorykitchen appliancebitternut hickorychicken casserolehot-rock penstemonport jackson heathhypophyseal stalkchicken drumsticksonoran whipsnakefrancis hopkinsonalan lloyd hodgkinelizabeth gaskellhall's honeysucklemikhail gorbachevgeorge walker bushamerican white oakswamp chestnut oakphotoplate makingprzevalski's horseprzewalski's horserough-skinned newtmikhail lermontovchicken paprikashchicken roundwormshortbread cookieswamp honeysucklecardiogenic shock
...View all with 16 letters...
Words (7)
triskaidekaphobialeukoencephalitiskindheartednessesstraightjacketingtriskaidekaphobicthreskiornithidaebrokenheartednessPhrases (146)
john maynard keynesdwarf chinkapin oakal-hakim bi-amr allahkatsushika hokusaimount kanchenjungakiswahili languagecivil rights workershipwreck survivorlouis the wideawakechickasaw languagecharred pancake cupswallow-tailed hawksympathetic strikechicken cacciatorahub-and-spoke systemchicken cacciatoredesktop publishingchicken cordon bleuanaphylactic shockkilometers per hourcarolina buckthorncarolina chickadeehorned rattlesnakewhole kit and boodlekilometres per hourdrinking chocolatenorthern snakeheadchicken provencalehemorrhagic strokegenus schomburgkiathaddeus kosciuskostinking chamomilechristmas stockinggarden huckleberrychicken tetrazzini
...View all with 17 letters...
Words (2)
triskaidekaphobiaspocket-handkerchiefPhrases (105)
dwarf chinquapin oakhindu kush mountainsbottlebrush buckeyeeurasian kingfisheritalian honeysuckledame sybil thorndikebackspace characterarches national parkherbert clark hooverkalashnikov cultureheat-seeking missilealeksandr pavlovichnikolai lobachevskyaleksandr prokhorovshirley temple blackcalvin richard kleinmikhail baryshnikovanointing of the sickgenus kenyapithecustalk through one's hatkamchatka peninsulakamchatkan sea eaglealkaline-earth metalkamehameha the greatstinking nightshadegenus bruckenthaliapembroke welsh corgicalifornia white oakdmitri shostakovichyevgeni yevtushenkoyevgeny yevtushenkomexican black cherryalexander prokhorovgenus archidiskidonharkat ul-mujahedeen
...View all with 18 letters...
Words (2)
phosphofructokinasemakataimeshekiakiakPhrases (87)
embryoma of the kidneynorthern cricket froglepidothamnus fonkiihard-skinned puffballredheaded woodpeckershakespearean sonnethandle with kid glovesedgeworth-kuiper beltshirodkar's operationcapital of kazakhstankayser-fleischer ringwhole kit and caboodleskeleton in the closetchocolate chip cookieswamp fly honeysucklecalifornia buckthorncalifornia buckwheatvalentina tereshkovaernst ludwig kirchnerinsulin shock therapylittle-head snakeweedumar al-mukhtar forcessmallmouth black bassarthur edwin kennellyeuropean honeysucklejapanese honeysucklecapital of north koreacalifornia whipsnakeenglish breakfast tealymphocytic leukemiaover the counter stockc. northcote parkinsonmother carey's chickenkinetic theory of heatturkish monetary unit
...View all with 19 letters...
Words (1)
phosphofructokinasesPhrases (65)
black-capped chickadeeyellow-shafted flickerdwarf golden chinkapinpsychopsis kramerianahemlock water dropwortevergreen huckleberrychinese black mushroommetrazol shock therapynerve block anesthesiastephen butler leacocknorthern pocket gopherbluethroat pikeblennymikir-meithei languagesnake's head fritillaryfriedrich alfred krupprepublic of kazakhstanernst heinrich haeckelmechanically skillfulemil klaus julius fuchsengelbert humperdinckeuropean house cricketarthur jacob arshawskycapital of north dakotahexalectris warnockiihendrik antoon lorentzenglish cocker spanielhendrik petrus berlageklemens von metternichwilhelm konrad rontgenhugo alvar henrik aaltokinetic theory of gasesharkat-ul-jihad-e-islamiover-the-counter marketwerner karl heisenbergmacrocheira kaempferi
...View all with 20 letters...
Phrases (70)
sir john cowdery kendrewpresident john f. kennedyschlumbergera buckleyiamerican stock exchangenerve block anaesthesiaigor ivanovich sikorskyaleksandr solzhenitsynthin-leaved stringybarkbabe didrikson zahariasketamine hydrochloridewinter crookneck squashskeleton in the cupboardstephen william hawkinggreater prairie chickenketorolac tromethaminefriedrich august kekuleoriental black mushroomgenus krypterophaneroninsulin shock treatmentpeter ilich tchaikovskysmallmouthed black basstennessee walking horsearam ilich khachaturianlymphoblastic leukemiawilhelm konrad roentgenharkat-ul-jihad al-islamikonrad zacharias lorenzking arthur's round tableharley granville-barkercasemaking clothes mothanton pavlovich chekhovantonie van leeuwenhoekforces of umar al-mukhtardaniel patrick moynihangustav robert kirchhoff
...View all with 21 letters...
Phrases (46)
black-crowned night heroncharlotte perkins gilmangilbert keith chestertonblack-fronted bush shrikehot springs national parksubdivision ginkgophytaaleksandr i. solzhenitsynhydraulic brake cylindermetrazol shock treatmentarchidiskidon imperatorjohn ronald reuel tolkienfrancis richard stocktonmikhail ivanovich glinkabattle of the bismarck seaplantation walking horseernestine schumann-heinkeuropean fly honeysucklehendrik frensch verwoerdjohns hopkins universityboris vasilevich spasskyshenandoah national parkfrank winfield woolworthbuckleya distichophyllaarcuate vein of the kidneyblack english vernacularburrhus frederic skinnerfirst duke of marlboroughthree-spined sticklebackroman osipovich jakobsonsaddle block anaesthesiachesapeake bay retrievermatthias jakob schleidenkennelly-heaviside layerjohn davison rockefellerpyotr ilyich tchaikovsky
...View all with 22 letters...
Phrases (45)
ragnar anton kittil frischsir john douglas cockcroftfamily threskiornithidaetransient ischemic attacknikolai vasilievich gogolmammoth cave national parkmikhail ivanovich kalininkazakhstani monetary unitbattle of the caudine forksfriedrich august von hayekchristoph willibald glucktheory of weak interactionsarvepalli radhakrishnanwernicke's encephalopathydorothy rothschild parkersouth korean monetary unitbraxton-hicks contractiontyrosine kinase inhibitorvirginia katherine mcmathdual inline package switchdomenikos theotocopoulospink-and-white everlastingwilliam bradford shockleytrofim denisovich lysenkocyril northcote parkinsonwilliam cuthbert faulknerhypertext mark-up languagehypertext markup languagekingdom of the netherlandsphonograph recording diskbecker muscular dystrophysir anthony philip hopkinssir frederick handley pagenorth korean monetary unitjohn james rickard macleod
...View all with 23 letters...
Phrases (29)
hashemite kingdom of jordansubdivision ginkgophytinadivision heterokontophytamaxfield frederick parrishnikolai ivanovich bukharinaleksey maximovich peshkovfrancis henry compton crickbattledore and shuttlecockanatoli yevgenevich karpovjohann joachim winckelmannarcuate artery of the kidneyrichard buckminster fullersoutheastern pocket gopherlucy in the sky with diamondsmohandas karamchand gandhihuman t-cell leukemia virus-1domesticated silkworm mothayatollah ruholla khomeinicharles christopher parkerdavid lewelyn wark griffithbahasa kebangsaan languagecharles franklin ketteringcharles john huffam dickensandrei andreyevich gromyko4.5-inch beach barrage rocketacute lymphocytic leukemianaked as the day you were bornkatharine houghton hepburnkund johan victor rasmussenPhrases (26)
melville louis kossuth deweyigor fyodorovich stravinskyangus frank johnstone wilsonaleksey maksimovich peshkovmikhail yurievich lermontovsecond marquis of rockinghamboris leonidovich pasternakmodest petrovich mussorgskyrudolf christian karl dieselchamaecyparis nootkatensiscapital of the united kingdomvon recklinghausen's diseasechronic myelocytic leukemiafederal home loan bank systemhenry kenneth alfred russellcommunist party of kampucheasaddam bin hussein at-takritibruckenthalia spiculifoliapyotr alexeyevich kropotkincharles frederick menningerrashtriya swayamsevak sanghnorth cascades national parkandrei arsenevich tarkovskywilliam makepeace thackeraybranched chain ketoaciduriakeratoderma blennorrhagicaPhrases (29)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkgeorge iv of the united kingdomx-linked dominant inheritancemikhail ilarionovich kutuzovsir sarvepalli radhakrishnanfriedrich gottlieb klopstockchristoph willibald von gluckalexander alexandrovich blokparty of democratic kampucheamodest petrovich moussorgskydorothy mary crowfoot hodgkinkeep one's shoulder to the wheeljohannes diderik van der waalsfirst baron marks of broughtonchronic lymphocytic leukemiaemployee stock ownership planliters per hundred kilometersbooker taliaferro washingtonsir frederick gowland hopkinssergei sergeyevich prokofievandrei dimitrievich sakharovbaron richard von krafft-ebingacute lymphoblastic leukemiabaroness jackson of lodsworthbaroness thatcher of kestevenlitres per hundred kilometreskathleen mansfield beauchampPhrases (28)
rodion romanovich raskolnikovgeorge iii of the united kingdomnikita sergeyevich khrushchevholy roman emperor frederick iialeksandr aleksandrovich bloknikolai ivanovich lobachevskyaleksandr porfirevich borodinaleksandr sergeyevich pushkinx-linked recessive inheritancemikhail sergeyevich gorbachevkazimir severinovich malevichdirector-stockholder relationgeorgi konstantinovich zhukovrudbeckia laciniata hortensiakeep one's nose to the grindstonejerusalem artichoke sunflowerjohannes evangelista purkinjehawai'i volcanoes national parkhawaii volcanoes national parktaras grigoryevich shevchenkoindustrial workers of the worldmujahidin-e khalq organizationmartin luther king jr's birthdaywilliam iv of the united kingdombaron karl wilhelm von humboldtsir frederick william herschelmaurice hugh frederick wilkinssclerosing leukoencephalitisPhrases (15)
count lev nikolayevitch tolstoyaleksandr feodorovich kerenskymikhail aleksandrovich bakuninfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskymildred ella didrikson zahariasgates of the arctic national parkkonstantin sergeevich alekseevfeodor mikhailovich dostoevskifeodor mikhailovich dostoevskyfirst earl kitchener of khartoumpatrick victor martindale whitevladimir vladimirovich nabokovalpha-adrenergic blocking agentsergei mikhailovich eisensteinWords (1)
hexakosioihexekontahexaphobiaPhrases (11)
theodore roosevelt national parkaleksandr nikolayevich scriabinstephanus johannes paulus krugerlydia kamekeha paki liliuokalanifyodor mikhailovich dostoyevskydmitri dmitrievich shostakovichgrigori aleksandrovich potemkinalfred habdank skarbek korzybskifeodor mikhailovich dostoyevskybernd heinrich wilhelm von kleistvyacheslav mikhailovich molotovPhrases (1)
friedrich august kekule von stradonitz