Words Containing: H,A,K,E
(In Any Order)
There are 1,346 words,
1,420 phrases and
0 abbr's with
H,A,K,E in.
Best Scoring Words With H,A,K,E
More words | |||||||
---|---|---|---|---|---|---|---|
Rank | Word | Save? | Length | Usage | Points | Type | |
1 | khazens | 7 | 23 | nounn | |||
2 | khazen | 6 | 22 | nounn | |||
3 | whacked | 7 | 20 | verb, adjectivev, adj | |||
4 | hawkeys | 7 | 20 | verbv | |||
5 | hackney | 7 | 19 | noun, adjectiven, adj | |||
6 | whacker | 7 | 19 | nounn | |||
7 | hackery | 7 | 19 | nounn | |||
8 | hawkey | 6 | 19 | noun, adjectiven, adj | |||
9 | chacked | 7 | 19 | verbv | |||
10 | backhoe | 7 | 18 | nounn | |||
or scroll down to see all results... | |||||||
Tip: Scrabble EU allows far more words than US! Also change the max length to see more words. |
Words (1)
hake11Words (44)
shaken13hacker15shaker13harken13hawker16hankie13hackie15hanker13hakeem15hawkey19hackle15ashake13haceks15ashkey16shaked14hacked16shakes13sheikapakeha15bekahs15kanehs13kechuasamekh15sakieh13keblah15khazen22khedah17khedas14keddah15hankeyhawked17takahe13hawkie16ash-keyphreak15
...View all with 6 letters...
Words (81)
whacked20rebekahshackle16shakers14hackney19backhoe18whacker19eckhartshakeup16thankee14hearken14hackery19hauberk16shakier14hotcake16hackles16weakish17wykehamshake-upcharked17ashkeys17hackees16haglike15hackers16pakehas16sheikha17shakoes14hackies16hackled17hackler16hacklet16hoecake16bethank16hackmen18kechuan
...View all with 7 letters...
Phrases (5)
hen hawkash caketax hikemake hayhot cakeWords (154)
paycheck24skinhead16hijacker24bulkhead18shackled18archduke18shakiest15backache21freakish18chickpea21headlock18hezekiahshiitake15deckhand19tashkentlunkhead16latchkey20havelock20tuckahoe17bakeshop19shellack17headwork19hawknose18unshaken15kreplach19herakleshairlike15cakeholekeelhaul15bankheadhatcheck22haymaker20dakerhen16shakable17ashcakes17
...View all with 8 letters...
Phrases (21)
heat sinkshake offmeat hookred chalkwage hikeskew archkeel archwatch keyjunk heapbad checkark shellwhite oakreap hooktake a hittake a hophawk nosetake heedtake holdeach weekfish cakelake chadWords (233)
sheldrake17handshake20skinheads17checkmate22horseback20blockhead21milkshake22shoemaker18makeshift21akhenatenartichoke18thankless16handbrake19buckwheat23shakedown20homemaker20ashkenazimarrakeshhankering17shortcake18lakeshore16snakehead17marrakechchickadee21shrinkage17blackhead21haversack21raincheck20thickhead22headstock19hackamore20thackerayhackneyed22benchmark22earthlike16
...View all with 9 letters...
Phrases (55)
lake hurondisk cachetank shellmeat hooksfish steakdisk shapelake tahoewhite cakeskeen archhoney cakechain pikelike a shotskene archsketch mapsketch padturk's headcocked hatrain checkpark benchchoke backchalk lineshock wavejohann eckshoe blackbank checkhave a lookcheck markant shrikephone jackhuman kneeblack holechop steaksay hey kidhooke's lawmake happy
...View all with 9 letters...
Words (240)
earthquake26heartbreak19cheesecake21cheapskate21matchmaker23jackhammer30steakhouse17watchmaker24heatstroke17aftershock22freakishly23unshakable19shirtmaker19hammerlock23housebreak19backhanded23humpbacked26ramshackle21sheepshank22threadlike18blackheart21checkmated24saltshaker17handbasket20boneshaker19homemaking22reichsmark21shoemaking20unshackled20backhander22backsheesh24packsheets21shoeblacks21rakeshames19backrushes21
...View all with 10 letters...
Phrases (76)
nurse sharkoff-the-rackhard workershake handshead gasketsilver hakehockey gamestrike hardwhale sharkhockey teamgenus khayashish kebabwelsh blackjohn walkerlemon sharkphrase bookgenus hakeatiger sharkhair strokepigeon hawkjohnny cakeherman woukblack beechshank's marejakob boehmshanks' marejakob bohmekeyhole sawenglish oaksouth korealock washerangel sharksneak thiefblack deathhigher rank
...View all with 10 letters...
Words (236)
shakespeareheartbroken20unthinkable20knucklehead25hypermarket25tutankhamenunshakeable20speechmaker24nightwalker22backstretch24hunchbacked28kindhearted20hypokalemia25weathercock25hypokalemic27leatherneck20deutschmarkchucklehead26blockheaded24thickheaded25mawkishness23kinesthesia18phrasemaker22backbencher26kitchenware23steakhouses18bushwhacker28leatherback22shellacking21thickspreadflashbacked26stickhandle21packthreads23weakhearted22lanzknechts29
...View all with 11 letters...
Phrases (105)
tribal sheikcrank handlekiller whalehandies peakhub-and-spokehockey coachskeeter hawkchicken farmhockey skatewhale suckerchicken hawkthorny skatedasht-e-kavirhome bankinggenus kochiajenghiz khanchicken tacokamehameha ichicken yardshell jacketparity checktalking headmasked shrewcooper's hawkhare krishnawatch pocketpatch pocketslash pocketshamrock peaalkyl halidechatter markthread makerjakob behmenfrank breechjakob boehme
...View all with 11 letters...
Words (143)
handkerchief28breakthrough25breathtaking22heartbreaker21thessalonikispeakerphone23speechmaking26czechoslovaksaskatchewanhyperkalemiapackinghouse24thankfulness22checkerboard26headshrinker23swashbuckler26earthshaking23stakhanovite22thanksgivers23stickhandled23heterokontaestickhandler22merchantlike23stickhandles22rakishnesses19schecklatons23nikethamides22speechmakers25skrimshanked26skrimshanker25googlewhacks26earthquaking29backsheeshed27backsheeshes26prankishness21earthshakers22
...View all with 12 letters...
Phrases (108)
deutsche marktribal sheikhlake michigandisk overheadstrike a chordhockey leaguehockey playerathletic sockkitchen matchsnake charmerhockey seasonkurt waldheimkitchen rangehot-water tankkitchen tablewhite croakersea of okhotskshelf bracketchicken saladchicken snakeernst haeckelhatcheck girljohn van vleckarrester hookmerchant bankhome loan bankmackerel shadfor the askinglashkar-e-omarklamath riverklammath weedkanawha riverthunder snakehognose snakekangaroo hare
...View all with 12 letters...
Words (95)
heartbreaking23shakespeareanbackscratcher28brokenhearted23leatherjacket29kaffeeklatsch32housebreaking23chameleonlike24shakespearianholidaymakers26stickhandlers23weakishnesses23backscratched29backscratches28speechmakings27skrimshankers26backsheeshing28chickabiddies28hyperkinesias25sphairistikes22heterokaryons23whiskerandoed25spaghettilike23blatherskites22kinanesthesiastakhanovites23knuckleheaded28blockheadedly29headshrinkers24checkerboards27unscholarlike22handkerchiefs29nonshrinkable22backstretches26stalking-horse
...View all with 13 letters...
Phrases (124)
el iskandriyahwhite backlashsheepskin coathard-cooked eggmigrant shrikeshumard red oakswallow shrikechicken breastmetrazol shockkitchen gardenkitchen islandlake whitefishtomato ketchupjekyll and hydechain pickerelchicken manurechocolate cakechristmas cakesnake muishondtelephone jackchocolate kisstalk of the townfishing tacklegenus knightiachocolate milkalkaline earthgenus kohleriamashie niblickshell parakeetgenus hackeliaswamp white oakjohn wanamakermackerel sharkchickpea plantlashkar-e-taiba
...View all with 13 letters...
Words (46)
czechoslovakiastraightjacket31chickenhearted29unthankfulness24backscratchers29hydrokinetical27brackishnesses25hyperkeratoses26hyperkeratosis26hyperkeratotic28earthshakingly28omphaloskepsis27prankishnesses23heterokaryoses24heterokaryosis24heterokaryotic26thrombokinases25sneakishnesses21handkerchieves30keratinophilic25shock-absorbentweathercocking29harlequin-snakeleatherjackets30halterbreaking24omphaloskepses27housebreakings24phytoplankters28freakishnesses24mischief-makingpoikilothermal25bletheranskate23spokesmanships27backhandedness27french-speaking
...View all with 14 letters...
Phrases (132)
kalahari desertweather outlookanthony vandykelake okeechobeesir joseph bankskerosene heaterkerosine heaterhydraulic brakechicken and ricekitchen cabinetfisherman's knotsheet-metal workchinese cork oaknorthern pin oakblackberry bushsympathy strikestephen hawkingaround-the-clocknorthern red oakstephen leacockkazakh languagechicken marengochicken paprikahuckleberry oaktow-headed snakegenus kniphofiachicken scratchhoek van hollandchainlink fenceman-eating sharkbirchbark canoekechua languagefriedrich hayekalaska purchasedouglas hemlock
...View all with 14 letters...
Words (39)
czechoslovakianheartbreakingly28thankworthiness28brokenheartedly28chicken-breastedkind-heartednessthickheadedness29blockheadedness28kindheartedness24lymphoblast-likekinesthetically27kaffeeklatsches34straightjackets32pharmacokinetic30epikeratophakiaspanish-speakingenglish-speakingmicroearthquake35pinkish-lavenderheartbrokenness24thinkablenesses24phenylketonuria27bletheranskates24unchristianlike24heartsicknesses24unthinkableness24kinematographer27avalokiteshvaraunshakeableness24kinematographic29sketchabilities26phenakistoscope28kinesitherapies24keratoacanthomakatathermometer26
...View all with 15 letters...
Phrases (127)
field hockey balltadzhik languagealpine milk vetchkurdish languagein all likelihoodischaemic strokecanadian hemlockhydraulic brakesrough green snakegreat white sharkmaryland chickennorthern oak fernpinchas zukermancarolina hemlocksour mash whiskeysnake in the grassrough-legged hawkhodgkin's diseasepharaoh's chickenkazimir malevichpincushion hakeatreasurer's checkchicken sandwichsir seretse khamacrookneck squashkechuan languagearthur e. kennellywholesale marketmountain hemlocklashkar-e-jhangvilashkar-e-tayyibapawnbroker's shopparker house rollclammy chickweedredundancy check
...View all with 15 letters...
Words (9)
heterokontophytaunthinkabilitieskinaestheticallypharmacokineticsstraightjacketedphenylketonuriasheterokaryosisesmicroearthquakeskrypterophaneronPhrases (98)
nikita khrushchevkurdish hezbollahblack-headed snakechemakum languagecooking chocolatekitchen appliancechicken casseroleport jackson heathhypophyseal stalksonoran whipsnakeelizabeth gaskellhall's honeysucklemikhail gorbachevgeorge walker bushamerican white oakswamp chestnut oakphotoplate makingprzevalski's horseprzewalski's horsemikhail lermontovchicken paprikashshortbread cookieswamp honeysucklecardiogenic shockchinese silk plantblackheart cherryalaska rein orchidhunkpapa languageporterhouse steakshellbark hickorygenus acokantherapeter tchaikovskyhabenaria hookeriwilhelm karl grimmalexander pushkin
...View all with 16 letters...
Words (7)
triskaidekaphobialeukoencephalitiskindheartednessesstraightjacketingtriskaidekaphobicthreskiornithidaebrokenheartednessPhrases (96)
john maynard keynesmount kanchenjungakiswahili languagelouis the wideawakechickasaw languagecharred pancake cupswallow-tailed hawksympathetic strikechicken cacciatorahub-and-spoke systemchicken cacciatorecarolina chickadeehorned rattlesnakewhole kit and boodledrinking chocolatenorthern snakeheadchicken provencalehemorrhagic strokegenus schomburgkiathaddeus kosciuskostinking chamomilegarden huckleberrychicken tetrazzinioriental cockroachhoneysuckle familyabkhasian languageeuropean hackberryabkhazian languagenorwegian elkhoundgreek architectureshelton jackson leekyphosus sectatrixchinookan languagerattlesnake orchidblackthorn liqueur
...View all with 17 letters...
Words (2)
triskaidekaphobiaspocket-handkerchiefPhrases (76)
eurasian kingfisheritalian honeysuckledame sybil thorndikebackspace characterarches national parkherbert clark hooverkalashnikov cultureheat-seeking missilealeksandr pavlovichnikolai lobachevskyaleksandr prokhorovshirley temple blackcalvin richard kleinanointing of the sickgenus kenyapithecustalk through one's hatkamchatka peninsulakamchatkan sea eaglealkaline-earth metalkamehameha the greatstinking nightshadegenus bruckenthaliacalifornia white oakmexican black cherryalexander prokhorovgenus archidiskidonharkat ul-mujahedeenharkat-ul-mujahideenvalley pocket gopherhokkianese languageking charles spanielklyuchevskaya sopkabrick-making machinejerusalem artichokecakchiquel language
...View all with 18 letters...
Words (2)
phosphofructokinasemakataimeshekiakiakPhrases (68)
embryoma of the kidneylepidothamnus fonkiihard-skinned puffballredheaded woodpeckershakespearean sonnethandle with kid glovesshirodkar's operationkayser-fleischer ringwhole kit and caboodlechocolate chip cookieswamp fly honeysucklecalifornia buckwheatvalentina tereshkovainsulin shock therapylittle-head snakeweedumar al-mukhtar forcesarthur edwin kennellyeuropean honeysucklejapanese honeysucklecapital of north koreacalifornia whipsnakeenglish breakfast tealymphocytic leukemiac. northcote parkinsonmother carey's chickenkinetic theory of heatturkish monetary unitfrank breech deliverycapital of south koreabrick-molding machinegerard manley hopkinsround-the-clock patrolhairstreak butterflyanton van leeuwenhoekdibranchiate mollusk
...View all with 19 letters...
Words (1)
phosphofructokinasesPhrases (52)
black-capped chickadeeyellow-shafted flickerdwarf golden chinkapinpsychopsis kramerianahemlock water dropwortchinese black mushroommetrazol shock therapynerve block anesthesiastephen butler leacockbluethroat pikeblennymikir-meithei languagesnake's head fritillaryfriedrich alfred krupprepublic of kazakhstanernst heinrich haeckelmechanically skillfulemil klaus julius fuchseuropean house crickethexalectris warnockiihendrik antoon lorentzenglish cocker spanielhendrik petrus berlagewilhelm konrad rontgenhugo alvar henrik aaltokinetic theory of gasesharkat-ul-jihad-e-islamiover-the-counter marketwerner karl heisenbergmacrocheira kaempferianton pavlovich chekovhenry alfred kissingerhistiocytic leukaemiachronic kidney failurecheck overdraft creditrichard erskine leakey
...View all with 20 letters...
Phrases (58)
schlumbergera buckleyiamerican stock exchangenerve block anaesthesiaaleksandr solzhenitsynthin-leaved stringybarkbabe didrikson zahariasketamine hydrochloridewinter crookneck squashskeleton in the cupboardstephen william hawkinggreater prairie chickenketorolac tromethaminefriedrich august kekuleoriental black mushroomgenus krypterophaneroninsulin shock treatmentpeter ilich tchaikovskysmallmouthed black basstennessee walking horselymphoblastic leukemiawilhelm konrad roentgenkonrad zacharias lorenzking arthur's round tableharley granville-barkercasemaking clothes mothanton pavlovich chekhovantonie van leeuwenhoekforces of umar al-mukhtardaniel patrick moynihangustav robert kirchhoffjarvik artificial heartalfred joseph hitchcockaustralian honeysucklenew zealand honeysucklesaddle block anesthesia
...View all with 21 letters...
Phrases (36)
black-crowned night heroncharlotte perkins gilmanblack-fronted bush shrikealeksandr i. solzhenitsynhydraulic brake cylindermetrazol shock treatmentarchidiskidon imperatorjohn ronald reuel tolkienbattle of the bismarck seaplantation walking horseernestine schumann-heinkeuropean fly honeysuckleboris vasilevich spasskyshenandoah national parkfrank winfield woolworthbuckleya distichophyllaarcuate vein of the kidneyblack english vernacularfirst duke of marlboroughthree-spined sticklebacksaddle block anaesthesiachesapeake bay retrievermatthias jakob schleidenkennelly-heaviside layerjohn davison rockefellerbook of the prophet danielthreskiornis aethiopicaamerican fly honeysucklesulphur-crested cockatoomartin heinrich klaproththomas hopkins gallaudetalpha-adrenergic blockernizhnyaya tunguska rivermediterranean hackberryblack vernacular english
...View all with 22 letters...
Phrases (36)
family threskiornithidaetransient ischemic attacknikolai vasilievich gogolmammoth cave national parkkazakhstani monetary unitbattle of the caudine forksfriedrich august von hayektheory of weak interactionsarvepalli radhakrishnanwernicke's encephalopathydorothy rothschild parkersouth korean monetary unittyrosine kinase inhibitorvirginia katherine mcmathdual inline package switchpink-and-white everlastingwilliam bradford shockleycyril northcote parkinsonwilliam cuthbert faulknerhypertext mark-up languagehypertext markup languagekingdom of the netherlandsphonograph recording diskbecker muscular dystrophysir frederick handley pagenorth korean monetary unitjohn james rickard macleodnaked as the day one was bornhoratio herbert kitchenercheyne-stokes respirationsluzhba vneshney razvedkikeratosis blennorrhagicayuri alekseyevich gagaringeorge herbert walker bushtjalling charles koopmans
...View all with 23 letters...
Phrases (26)
hashemite kingdom of jordandivision heterokontophytamaxfield frederick parrishaleksey maximovich peshkovfrancis henry compton crickbattledore and shuttlecockanatoli yevgenevich karpovjohann joachim winckelmannarcuate artery of the kidneyrichard buckminster fullersoutheastern pocket gopherlucy in the sky with diamondshuman t-cell leukemia virus-1domesticated silkworm mothayatollah ruholla khomeinicharles christopher parkerdavid lewelyn wark griffithbahasa kebangsaan languagecharles franklin ketteringcharles john huffam dickensandrei andreyevich gromyko4.5-inch beach barrage rocketacute lymphocytic leukemianaked as the day you were bornkatharine houghton hepburnkund johan victor rasmussenPhrases (23)
angus frank johnstone wilsonaleksey maksimovich peshkovmikhail yurievich lermontovsecond marquis of rockinghamboris leonidovich pasternakrudolf christian karl dieselchamaecyparis nootkatensiscapital of the united kingdomvon recklinghausen's diseasechronic myelocytic leukemiafederal home loan bank systemhenry kenneth alfred russellcommunist party of kampucheasaddam bin hussein at-takritibruckenthalia spiculifoliapyotr alexeyevich kropotkincharles frederick menningerrashtriya swayamsevak sanghnorth cascades national parkandrei arsenevich tarkovskywilliam makepeace thackeraybranched chain ketoaciduriakeratoderma blennorrhagicaPhrases (18)
helen maria fiske hunt jacksoncharlotte anna perkins gilmanchannel islands national parkx-linked dominant inheritancesir sarvepalli radhakrishnanalexander alexandrovich blokparty of democratic kampucheajohannes diderik van der waalschronic lymphocytic leukemiaemployee stock ownership planbooker taliaferro washingtonsir frederick gowland hopkinsandrei dimitrievich sakharovbaron richard von krafft-ebingacute lymphoblastic leukemiabaroness jackson of lodsworthbaroness thatcher of kestevenkathleen mansfield beauchampPhrases (25)
nikita sergeyevich khrushchevholy roman emperor frederick iialeksandr aleksandrovich bloknikolai ivanovich lobachevskyaleksandr porfirevich borodinaleksandr sergeyevich pushkinx-linked recessive inheritancemikhail sergeyevich gorbachevkazimir severinovich malevichdirector-stockholder relationgeorgi konstantinovich zhukovrudbeckia laciniata hortensiajerusalem artichoke sunflowerjohannes evangelista purkinjehawai'i volcanoes national parkhawaii volcanoes national parktaras grigoryevich shevchenkoindustrial workers of the worldmujahidin-e khalq organizationmartin luther king jr's birthdaywilliam iv of the united kingdombaron karl wilhelm von humboldtsir frederick william herschelmaurice hugh frederick wilkinssclerosing leukoencephalitisPhrases (14)
count lev nikolayevitch tolstoyaleksandr feodorovich kerenskymikhail aleksandrovich bakuninfyodor mikhailovich dostoevskifyodor mikhailovich dostoevskymildred ella didrikson zahariasgates of the arctic national parkkonstantin sergeevich alekseevfeodor mikhailovich dostoevskifeodor mikhailovich dostoevskyfirst earl kitchener of khartoumpatrick victor martindale whitealpha-adrenergic blocking agentsergei mikhailovich eisensteinWords (1)
hexakosioihexekontahexaphobiaPhrases (10)
theodore roosevelt national parkaleksandr nikolayevich scriabinstephanus johannes paulus krugerlydia kamekeha paki liliuokalanifyodor mikhailovich dostoyevskydmitri dmitrievich shostakovichgrigori aleksandrovich potemkinalfred habdank skarbek korzybskifeodor mikhailovich dostoyevskyvyacheslav mikhailovich molotovPhrases (1)
friedrich august kekule von stradonitz